Patents Assigned to NATIONAL UNIVERSITY CORPORATION ASAHIKAWA MEDICAL
  • Patent number: 11752180
    Abstract: The present invention provides an intestinal tract protective agent comprising a polyphosphoric acid or a pharmaceutically acceptable salt thereof as an active ingredient.
    Type: Grant
    Filed: August 6, 2020
    Date of Patent: September 12, 2023
    Assignees: National University Corporation Asahikawa Medical University, Sapporo Holdings Limited
    Inventors: Yutaka Kohgo, Mikihiro Fujiya, Nobuhiro Ueno, Syuichi Segawa, Naoyuki Kobayashi
  • Publication number: 20230218165
    Abstract: A medical system of an aspect example includes a data acquiring unit and a data processor. The data acquiring unit is configured to acquire data from an eye fundus of a patient using at least one optical method. The data processor is configured to process the data acquired by the data acquiring unit in order to generate information on the circulatory system of the patient.
    Type: Application
    Filed: September 21, 2021
    Publication date: July 13, 2023
    Applicants: Topcon Corporation, National University Corporation Asahikawa Medical University
    Inventors: Kana MINAMIDE, Masahiro AKIBA, Jun SAKAI, Akitoshi YOSHIDA
  • Patent number: 11602146
    Abstract: A connector (1) includes: a tube (10) configured to be arranged in an interior of a vascular channel; a tubular body (30) having an inner wall surface configured to, together with an outer wall surface of the tube (10), sandwich the vascular channel when the tube (10) is arranged in the interior of the vascular channel; and a balloon (20), configured to be arranged on the outer wall surface of the tube (10) or the inner wall surface of the tubular body (30), and radially expand for performing sealing (i) between the soft tubular member and the inner wall surface of the tubular body (30) and (ii) between the soft tubular member and the outer wall surface of the tube (10). A fluid supply system (100) may include the connector (1), and a perfusion solution supply device (120) connected to the connector (1) and configured to supply a perfusion solution into the interior of the vascular channel.
    Type: Grant
    Filed: March 15, 2018
    Date of Patent: March 14, 2023
    Assignees: National University Corporation Kitami Institute of Technology, National University Corporation Asahikawa Medical University
    Inventors: Masanori Matsumura, Naoto Matsuno, Jun-Ichi Shibano, Yutaka Yoshida, Michihiro Sato, Hiroyuki Furukawa
  • Publication number: 20220152173
    Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.
    Type: Application
    Filed: February 3, 2022
    Publication date: May 19, 2022
    Applicant: National University Corporation Asahikawa Medical University
    Inventors: Takayuki Ohkuri, Akemi Kosaka, Hiroya Kobayashi
  • Publication number: 20220152172
    Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.
    Type: Application
    Filed: February 3, 2022
    Publication date: May 19, 2022
    Applicant: National University Corporation Asahikawa Medical University
    Inventors: Takayuki Ohkuri, Akemi Kosaka, Hiroya Kobayashi
  • Publication number: 20220152174
    Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.
    Type: Application
    Filed: February 3, 2022
    Publication date: May 19, 2022
    Applicant: National University Corporation Asahikawa Medical University
    Inventors: Takayuki Ohkuri, Akemi Kosaka, Hiroya Kobayashi
  • Publication number: 20210386290
    Abstract: The blood flow analysis apparatus includes an acquisition unit and an extractor. The acquisition unit is configured to acquire blood flow information representing time-course changes in a blood flow velocity of a single retinal artery or retinal vein. The extractor is configured to extract one or more parameters corresponding to change in the blood flow velocity from the blood flow information.
    Type: Application
    Filed: May 13, 2021
    Publication date: December 16, 2021
    Applicants: National University Corporation ASAHIKAWA MEDICAL UNIVERSITY, Topcon Corporation
    Inventors: Akitoshi YOSHIDA, Kana MINAMIDE, Masahiro AKIBA, Jun SAKAI
  • Patent number: 10980416
    Abstract: A blood flow measurement apparatus of an embodiment includes an image acquisition unit, an image region specification unit, a measurement location setting unit, a scanner, and a blood flow information generation unit. The image acquisition unit acquires an image of a living body. The image region specification unit analyzes the image to specify a plurality of blood vessel regions. The measurement location setting unit sets a plurality of measurement locations that intersects with the plurality of blood vessel regions. The scanner scans a plurality of cross sections of the living body corresponding to the plurality of measurement locations using optical coherence tomography. The blood flow information generation unit generates blood flow information on the living body based on data acquired through the scan.
    Type: Grant
    Filed: November 2, 2015
    Date of Patent: April 20, 2021
    Assignees: National University Corporation ASAHIKAWA MEDICAL UNIVERSITY, KABUSHIKI KAISHA TOPCON
    Inventors: Akitoshi Yoshida, Masahiro Akiba
  • Publication number: 20210038703
    Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.
    Type: Application
    Filed: February 15, 2019
    Publication date: February 11, 2021
    Applicant: National University Corporation Asahikawa Medical University
    Inventors: Takayuki Ohkuri, Akemi Kosaka, Hiroya Kobayashi
  • Patent number: 10898088
    Abstract: The disclosure provides technology for analyzing video data of a fluorescent contrast agent shot by a microscope during an operation, and provides a method and system allowing information such as BV, BF and MTT, and vascular wall thickness, to be estimated by fluorescent contrast agent analysis, by applying perfusion analysis methods. The method for processing intravascular hemodynamics images is characterized by shooting video using infrared light, wherein the object of shooting is a portion of a blood vessel injected with a fluorescent contrast agent; performing image analysis of a shape of a chronological change curve of intensity values which are image outputs from the video shooting; and calculating relative data for blood volume and blood flow based on results of the image analysis.
    Type: Grant
    Filed: September 19, 2014
    Date of Patent: January 26, 2021
    Assignee: NATIONAL UNIVERSITY CORPORATION ASAHIKAWA MEDICAL UNIVERSITY
    Inventors: Kyosuke Kamada, Hideaki Hayashi
  • Publication number: 20200383319
    Abstract: A connector (1) includes: a tube (10) configured to be arranged in an interior of a vascular channel; a tubular body (30) having an inner wall surface configured to, together with an outer wall surface of the tube (10), sandwich the vascular channel when the tube (10) is arranged in the interior of the vascular channel; and a balloon (20), configured to be arranged on the outer wall surface of the tube (10) or the inner wall surface of the tubular body (30), and radially expand for performing sealing (i) between the soft tubular member and the inner wall surface of the tubular body (30) and (ii) between the soft tubular member and the outer wall surface of the tube (10). A fluid supply system (100) may include the connector (1), and a perfusion solution supply device (120) connected to the connector (1) and configured to supply a perfusion solution into the interior of the vascular channel.
    Type: Application
    Filed: March 15, 2018
    Publication date: December 10, 2020
    Applicants: National University Corporation Kitami Institute of Technology, National University Corporation Asahikawa Medical University
    Inventors: Masanori MATSUMURA, Naoto MATSUNO, Jun-ichi SHIBANO, Yutaka YOSHIDA, Michihiro SATO, Hiroyuki FURUKAWA
  • Patent number: 10852517
    Abstract: Problem: To provide an observation auxiliary device that can appropriately and readily perform observation using an exciting light as a light source. Resolution Means: Provided are an imaging unit 104 that uses a light emitted from a second beam splitter 202 of a microscope 2 that can use an exciting light and an observation light, which is a light including a wavelength other than that of the exciting light, as a light source by switching there between and is provided with the second beam splitter 202 to image images of the same observation region of the microscope 2 in situations where the exciting light and the observation light are used as the light source and an output unit 106 that overlaps, synthesizes, and outputs the images imaged by the imaging unit 104 respectively using the exciting light and the observation light as the light source.
    Type: Grant
    Filed: May 24, 2016
    Date of Patent: December 1, 2020
    Assignee: National University Corporation Asahikawa Medical University
    Inventors: Kyosuke Kamada, Yukie Tamura, Fumiya Takeuchi
  • Publication number: 20200368299
    Abstract: The present invention provides an intestinal tract protective agent comprising a polyphosphoric acid or a pharmaceutically acceptable salt thereof as an active ingredient.
    Type: Application
    Filed: August 6, 2020
    Publication date: November 26, 2020
    Applicants: National University Corporation Asahikawa Medical University, Sapporo Holdings Limited
    Inventors: Yutaka Kohgo, Mikihiro Fujiya, Nobuhiro Ueno, Syuichi Segawa, Naoyuki Kobayashi
  • Patent number: 10792315
    Abstract: The present invention provides an intestinal tract protective agent comprising a polyphosphoric acid or a pharmaceutically acceptable salt thereof as an active ingredient.
    Type: Grant
    Filed: March 28, 2011
    Date of Patent: October 6, 2020
    Assignees: National University Corporation Asahikawa Medical University, Sapporo Holdings Limited
    Inventors: Yutaka Kohgo, Mikihiro Fujiya, Nobuhiro Ueno, Syuichi Segawa, Naoyuki Kobayashi
  • Patent number: 10588945
    Abstract: [Problem] To provide an agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same. [Solution] An agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same comprising parathyroid hormone or a derivative thereof as an active ingredient, characterized by being administered intermittently.
    Type: Grant
    Filed: July 4, 2016
    Date of Patent: March 17, 2020
    Assignees: ASAHI KASEI PHARMA CORPORATION, NATIONAL UNIVERSITY CORPORATION ASAHIKAWA MEDICAL UNIVERSITY
    Inventors: Hiromasa Tanino, Hiroshi Ito
  • Patent number: 10576126
    Abstract: [Problem] To provide a highly safe and efficacious antitumor agent that is derived from probiotics. [Solution] The present invention relates to an antitumor agent comprising a compound represented by formula (1) or a complex thereof as an active ingredient. In formula (1): R1 represents a hydrogen atom or a hydroxymethyl group; R2 represents a hydrogen atom, a methyl group or a hydroxymethyl group; and R3, R4 and R5 each independently represent a methyl group, an N5-(trans-5-hydroxy-3-methylpent-2-enoyl) group, an N5-(cis-5-hydroxy-3-methylpent-2-enoyl) group or an N5-(trans-4-carboxy-3-methylpent-2-enoyl) group. According to the present invention, a highly safe and efficacious antitumor agent can be provided.
    Type: Grant
    Filed: January 19, 2017
    Date of Patent: March 3, 2020
    Assignee: National University Corporation Asahikawa Medical University
    Inventors: Mikihiro Fujiya, Hiroaki Konishi, Kentaro Moriichi
  • Publication number: 20190022172
    Abstract: [Problem] To provide a highly safe and efficacious antitumor agent that is derived from probiotics. [Solution] The present invention relates to an antitumor agent comprising a compound represented by formula (1) or a complex thereof as an active ingredient. In formula (1): R1 represents a hydrogen atom or a hydroxymethyl group; R2 represents a hydrogen atom, a methyl group or a hydroxymethyl group; and R3, R4 and R5 each independently represent a methyl group, an N5-(trans-5-hydroxy-3-methylpent-2-enoyl) group, an N5-(cis-5-hydroxy-3-methylpent-2-enoyl) group or an N5-(trans-4-carboxy-3-methylpent-2-enoyl) group. According to the present invention, a highly safe and efficacious antitumor agent can be provided.
    Type: Application
    Filed: January 19, 2017
    Publication date: January 24, 2019
    Applicant: NATIONAL UNIVERSITY CORPORATION ASAHIKAWA MEDICAL MEDICAL
    Inventors: Mikihiro FUJIYA, Hiroaki KONISHI, Kentaro MORIICHI
  • Publication number: 20190010450
    Abstract: The present invention relates to an isolated mesenchymal stem cell-like human multipotent stem cell population characterized by being EphA7 positive, medical materials containing the cell population, and a method for producing the cell population comprising separating EphA7-positive cells from adherent cells derived from a tissue comprising capillary vessels.
    Type: Application
    Filed: July 29, 2016
    Publication date: January 10, 2019
    Applicants: National University Corporation ASAHIKAWA MEDICAL UNIVERSITY, DAIICHI SANKYO COMPANY, LIMITED
    Inventors: Junichi KAWABE, Taiji NAGAOKA, Akitoshi YOSHIDA, Naoyuki HASEBE
  • Publication number: 20180279874
    Abstract: A blood flow measurement apparatus of an embodiment includes an image acquisition unit, an image region specification unit, a measurement location setting unit, a scanner, and a blood flow information generation unit. The image acquisition unit acquires an image of a living body. The image region specification unit analyzes the image to specify a plurality of blood vessel regions. The measurement location setting unit sets a plurality of measurement locations that intersects with the plurality of blood vessel regions. The scanner scans a plurality of cross sections of the living body corresponding to the plurality of measurement locations using optical coherence tomography. The blood flow information generation unit generates blood flow information on the living body based on data acquired through the scan.
    Type: Application
    Filed: November 2, 2015
    Publication date: October 4, 2018
    Applicants: NATIONAL UNIVERSITY CORPORATION ASAHIKAWA MEDICAL UNIVERSITY, KABUSHIKI KAISHA TOPCON
    Inventors: Akitoshi YOSHIDA, Masahiro AKIBA
  • Publication number: 20180185454
    Abstract: [Problem] To provide an agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same. [Solution] An agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same comprising parathyroid hormone or a derivative thereof as an active ingredient, characterized by being administered intermittently.
    Type: Application
    Filed: July 4, 2016
    Publication date: July 5, 2018
    Applicants: ASAHI KASEI PHARMA CORPORATION, NATIONAL UNIVERSITY CORPORATION ASAHIKAWA MEDICAL UNIVERSITY
    Inventors: Hiromasa TANINO, Hiroshi ITO