Abstract: The present invention provides an intestinal tract protective agent comprising a polyphosphoric acid or a pharmaceutically acceptable salt thereof as an active ingredient.

Abstract: A medical system of an aspect example includes a data acquiring unit and a data processor. The data acquiring unit is configured to acquire data from an eye fundus of a patient using at least one optical method. The data processor is configured to process the data acquired by the data acquiring unit in order to generate information on the circulatory system of the patient.

Abstract: A connector (1) includes: a tube (10) configured to be arranged in an interior of a vascular channel; a tubular body (30) having an inner wall surface configured to, together with an outer wall surface of the tube (10), sandwich the vascular channel when the tube (10) is arranged in the interior of the vascular channel; and a balloon (20), configured to be arranged on the outer wall surface of the tube (10) or the inner wall surface of the tubular body (30), and radially expand for performing sealing (i) between the soft tubular member and the inner wall surface of the tubular body (30) and (ii) between the soft tubular member and the outer wall surface of the tube (10). A fluid supply system (100) may include the connector (1), and a perfusion solution supply device (120) connected to the connector (1) and configured to supply a perfusion solution into the interior of the vascular channel.

Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.

Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.

Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.

Abstract: The blood flow analysis apparatus includes an acquisition unit and an extractor. The acquisition unit is configured to acquire blood flow information representing time-course changes in a blood flow velocity of a single retinal artery or retinal vein. The extractor is configured to extract one or more parameters corresponding to change in the blood flow velocity from the blood flow information.

Abstract: A blood flow measurement apparatus of an embodiment includes an image acquisition unit, an image region specification unit, a measurement location setting unit, a scanner, and a blood flow information generation unit. The image acquisition unit acquires an image of a living body. The image region specification unit analyzes the image to specify a plurality of blood vessel regions. The measurement location setting unit sets a plurality of measurement locations that intersects with the plurality of blood vessel regions. The scanner scans a plurality of cross sections of the living body corresponding to the plurality of measurement locations using optical coherence tomography. The blood flow information generation unit generates blood flow information on the living body based on data acquired through the scan.

Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.

Abstract: The disclosure provides technology for analyzing video data of a fluorescent contrast agent shot by a microscope during an operation, and provides a method and system allowing information such as BV, BF and MTT, and vascular wall thickness, to be estimated by fluorescent contrast agent analysis, by applying perfusion analysis methods. The method for processing intravascular hemodynamics images is characterized by shooting video using infrared light, wherein the object of shooting is a portion of a blood vessel injected with a fluorescent contrast agent; performing image analysis of a shape of a chronological change curve of intensity values which are image outputs from the video shooting; and calculating relative data for blood volume and blood flow based on results of the image analysis.

Abstract: A connector (1) includes: a tube (10) configured to be arranged in an interior of a vascular channel; a tubular body (30) having an inner wall surface configured to, together with an outer wall surface of the tube (10), sandwich the vascular channel when the tube (10) is arranged in the interior of the vascular channel; and a balloon (20), configured to be arranged on the outer wall surface of the tube (10) or the inner wall surface of the tubular body (30), and radially expand for performing sealing (i) between the soft tubular member and the inner wall surface of the tubular body (30) and (ii) between the soft tubular member and the outer wall surface of the tube (10). A fluid supply system (100) may include the connector (1), and a perfusion solution supply device (120) connected to the connector (1) and configured to supply a perfusion solution into the interior of the vascular channel.

Abstract: Problem: To provide an observation auxiliary device that can appropriately and readily perform observation using an exciting light as a light source. Resolution Means: Provided are an imaging unit 104 that uses a light emitted from a second beam splitter 202 of a microscope 2 that can use an exciting light and an observation light, which is a light including a wavelength other than that of the exciting light, as a light source by switching there between and is provided with the second beam splitter 202 to image images of the same observation region of the microscope 2 in situations where the exciting light and the observation light are used as the light source and an output unit 106 that overlaps, synthesizes, and outputs the images imaged by the imaging unit 104 respectively using the exciting light and the observation light as the light source.

Abstract: The present invention provides an intestinal tract protective agent comprising a polyphosphoric acid or a pharmaceutically acceptable salt thereof as an active ingredient.

Abstract: The present invention provides an intestinal tract protective agent comprising a polyphosphoric acid or a pharmaceutically acceptable salt thereof as an active ingredient.

Abstract: [Problem] To provide an agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same. [Solution] An agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same comprising parathyroid hormone or a derivative thereof as an active ingredient, characterized by being administered intermittently.

Abstract: [Problem] To provide a highly safe and efficacious antitumor agent that is derived from probiotics. [Solution] The present invention relates to an antitumor agent comprising a compound represented by formula (1) or a complex thereof as an active ingredient. In formula (1): R1 represents a hydrogen atom or a hydroxymethyl group; R2 represents a hydrogen atom, a methyl group or a hydroxymethyl group; and R3, R4 and R5 each independently represent a methyl group, an N5-(trans-5-hydroxy-3-methylpent-2-enoyl) group, an N5-(cis-5-hydroxy-3-methylpent-2-enoyl) group or an N5-(trans-4-carboxy-3-methylpent-2-enoyl) group. According to the present invention, a highly safe and efficacious antitumor agent can be provided.

Abstract: The present invention relates to an isolated mesenchymal stem cell-like human multipotent stem cell population characterized by being EphA7 positive, medical materials containing the cell population, and a method for producing the cell population comprising separating EphA7-positive cells from adherent cells derived from a tissue comprising capillary vessels.

Abstract: A blood flow measurement apparatus of an embodiment includes an image acquisition unit, an image region specification unit, a measurement location setting unit, a scanner, and a blood flow information generation unit. The image acquisition unit acquires an image of a living body. The image region specification unit analyzes the image to specify a plurality of blood vessel regions. The measurement location setting unit sets a plurality of measurement locations that intersects with the plurality of blood vessel regions. The scanner scans a plurality of cross sections of the living body corresponding to the plurality of measurement locations using optical coherence tomography. The blood flow information generation unit generates blood flow information on the living body based on data acquired through the scan.

Abstract: [Problem] To provide an agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same. [Solution] An agent for preventing the onset of idiopathic osteonecrosis of the femoral head and/or suppressing the progress of the same comprising parathyroid hormone or a derivative thereof as an active ingredient, characterized by being administered intermittently.

Abstract: A method for examining a complement system of a subject, including: a reaction step of letting a scavenger receptor or a functional equivalent thereof, a pentraxin family protein or a functional equivalent thereof and a blood sample collected from the subject coexist in vitro; and a detection step of detecting complement activation amplifying reaction and/or complement activation late-phase reaction induced by interaction between the scavenger receptor or the functional equivalent thereof and the pentraxin family protein or the functional equivalent thereof from a reactant after the reaction step. Also provided are a kit for examining a complement system, and a method for testing a test substance for the ability to activate or suppress a complement system.