Patents Assigned to New York Blood Center, Inc.
  • Patent number: 6025476
    Abstract: The invention provides monospecific antibodies which are specifically reactive with the .alpha..sub.E subunit of fibrinogen or a fragment thereof, but not with other portions of the fibrinogen molecule. The invention also provides anti-.alpha..sub.E probes, including monospecific anti-.alpha..sub.E antibodies which have been detectably labeled. In addition, the invention provides methods of using the monospecific antibodies for detection of the .alpha..sub.E subunit and fragments thereof, as well as reagents and kits for performing the methods. Diagnostic methods for determining information associated with atherogenesis and/or thrombogenesis, as well as for determining information associated with pregnancy status or outcome. The invention further provides continuous cell lines which produce monospecific anti-.alpha..sub.E antibodies.
    Type: Grant
    Filed: October 6, 1998
    Date of Patent: February 15, 2000
    Assignee: New York Blood Center, Inc.
    Inventors: Gerd Grieninger, Yiping Fu, Yan Cao, Mohamad Zaher Ahadi, Bohdan J. Kudryk
  • Patent number: 6010890
    Abstract: The present invention provides methods for reducing the level of infectious virus contained in red blood cell compositions. The methods comprise the steps of contacting the composition with a photosensitizer formulated in a liposome carrier, and exposing the composition to light at a sufficient wavelength, dose and duration to reduce the level of infectious virus contained in the composition. In the methods of the present invention, a quencher, either alone or formulated in a liposome carrier, also may be added to the red blood cell composition before application of light. The present invention also provides compositions containing photosensitizers formulated in specific liposome carriers, as well as quenchers formulated in liposome carriers, for use in the methods of the present invention.
    Type: Grant
    Filed: April 29, 1997
    Date of Patent: January 4, 2000
    Assignee: New York Blood Center, Inc.
    Inventors: Ehud Ben-Hur, Maria M. Zuk
  • Patent number: 5985331
    Abstract: This invention relates to a method for inactivating parasites in blood cell-containing compositions by incubating a mixture of the blood cell-containing composition, a phthalocyanine dye and a quencher and optionally irradiating this mixture with red light. This invention further relates to a method of sterilizing blood cell-containing compositions which contain lipid enveloped viruses and blood borne parasites.
    Type: Grant
    Filed: June 5, 1998
    Date of Patent: November 16, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: Paul Gottlieb, Ehud Ben-Hur, Sara Lustigman
  • Patent number: 5985313
    Abstract: A method for decreasing the frequency of transmission of human immunodeficiency virus or herpesviruses by administering to a human an anti-human immunodeficiency virus amount or an anti-herpesvirus amount of cellulose acetate phthalate (CAP) or hydroxypropyl methylcellulose phthalate (HPMCP), such as in micronized form, or a combination thereof, either alone or in combination with a pharmaceutically acceptable carrier or diluent. The CAP and/or HPMCP may be employed as a suspension of micronized particles and may further contain a water miscible, non-solvent for CAP or HPMCP, such as glycerol.
    Type: Grant
    Filed: July 8, 1998
    Date of Patent: November 16, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: Alexander Robert Neurath, Asim Kumar Debnath, Shibo Jiang, Nathan Strick, Gordon Jay Dow
  • Patent number: 5981163
    Abstract: The present invention concerns the product produced by inactivating extracellular or intracellular pathogenic virus in a biological composition without incurring substantial disruption or inactivation of cells and without significant loss of labile proteins or other valuable biological components also contained therein, the inactivation process comprising subjecting said composition to a virucidally effective amount of irradiation in the presence of (a) a mixture of a compound that quenches type I photodynamic reactions and a compound that quenches type II photodynamic reactions or (b) a bifunctional compound that is capable of quenching both type I and type II reactions, to thereby inactivate said virus while retaining functionality of said composition. The composition is advantageously subjected to the irradiation and the mixture of compounds or bifunctional compound in the presence of an irradiation sensitizer.
    Type: Grant
    Filed: December 23, 1994
    Date of Patent: November 9, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: Bernard Horowitz, Bolanle Williams, Henrietta Margolis-Nunno, Sing N. Chin
  • Patent number: 5958677
    Abstract: The invention relates to a method for purification of viral RNA from a biological sample. The method involves lysing the virus envelope to liberate the RNA and passing the lysate through a porous hydrophilic PVDF filter to capture the viral RNA. The filter with bound RNA is then washed to remove proteins, lipids and other contaminants. The RNA is released from the filter using a low ionic strength ribonuclease (RNase) free solution to form a solution containing purified viral RNA. From this solution the RNA is recovered. The invention is also compatible with purification of nucleic acids from other types of samples.
    Type: Grant
    Filed: July 28, 1997
    Date of Patent: September 28, 1999
    Assignee: The New York Blood Center, Inc.
    Inventors: Dong-Hun Lee, Alfred M. Prince
  • Patent number: 5928214
    Abstract: A therapeutic product formed from a high concentration of white blood cells having a high degree of cell viability. The white blood cells are sequestered from their normal population presence in whole blood by placing the blood into a container and preventing coagulation of the blood, separating the blood into two components, one of which is extremely rich in white blood cells through the use of a reagent and centrifugation, sequestering the white cell concentration, and freezing the white cells.
    Type: Grant
    Filed: August 3, 1998
    Date of Patent: July 27, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: Pablo Rubinstein, Philip Henry Coelho, Cladd E. Stevens
  • Patent number: 5925541
    Abstract: The present invention relates to purified and isolated nucleic acid encoding the endo-.beta.-galactosidase from Flavobacterium keratolyticus (referred to as "ENDO-A"), and to purified ENDO-A protein. The endo-.beta.-galactosidase of the invention may be used in a process which enzymatically de-antigenizes human erythrocytes bearing A.sub.1 antigen. The resulting erythrocytes may be transfused into individuals who would be otherwise unable to tolerate a transfusion of type A.sub.1 blood.
    Type: Grant
    Filed: September 11, 1996
    Date of Patent: July 20, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: Jack Goldstein, Alex Zhu, Lin Leng
  • Patent number: 5922322
    Abstract: The invention provides a method of causing degradation of fibrin(ogen) (i.e., fibrin, fibrinogen, and related substances) by means of a fibrinolytic metalloproteinase, preferably an endogenous metalloproteinase such as MMP-3. The method of the invention can be performed in vitro to provide diagnostic information characterizing fibrin(ogen) and fibrinolytic physiology. The method can also be performed in vivo as a method of thrombolytic therapy in which a fibrinolytic metalloproteinase is administered to a subject to degrade thrombus in situ. The endogenous fibrinolytic metalloproteinase can be administered in conjunction with other active agents, preferably with agents having thrombolytic activity to improve thrombolytic and fibrinolytic therapy. The invention further provides compositions containing a fibrinolytic metalloproteinase for the performance of fibrinolytic or thrombolytic procedures.
    Type: Grant
    Filed: January 17, 1997
    Date of Patent: July 13, 1999
    Assignee: New York Blood Center, Inc.
    Inventor: Alessandra Bini
  • Patent number: 5912241
    Abstract: This invention relates to a method for inactivating parasites in blood cell-containing compositions by incubating a mixture of the blood cell-containing composition, a phthalocyanine dye and a quencher and optionally irradiating this mixture with red light. This invention further relates to a method of sterilizing blood cell-containing compositions which contain lipid enveloped viruses and blood borne parasites.
    Type: Grant
    Filed: November 17, 1997
    Date of Patent: June 15, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: Paul Gottlieb, Ehud Ben-Hur, Sara Lustigman
  • Patent number: 5911991
    Abstract: A composition and method for inhibiting binding of malarial Duffy-binding ligand to Duffy blood group antigens on mammalian erythrocytes is disclosed. The composition includes a Duffy-related peptide which interferes with binding between Duffy antigen expressed on erythrocyte cell surfaces and the Duffy-binding ligands of merozoites. Particularly preferred peptides are the peptides having the sequences AELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYD (SEQ ID NO:1) or AELSPSTQNSSQLNSDLWNFSYDGNDSFPDVDYD (SEQ ID NO:4), as well as peptides which comprise either of those sequences in their primary structure, or other peptides having equivalent function. A method is disclosed which comprises administering a Duffy-based peptide which interferes with malarial binding to Duffy antigen in an amount sufficient to inhibit binding of merozoites to erythrocytes.
    Type: Grant
    Filed: November 15, 1996
    Date of Patent: June 15, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: A. Oscar Pogo, Asok Chaudhuri
  • Patent number: 5895786
    Abstract: The present invention provides a method for treating a viral infection in a subject. The method comprises administering to the subject an amount of 5-aminolevulinic acid and an iron-chelating agent to cause virus-infected cells to accumulate protoporphyrin in amounts such that upon application of a sufficient dose of red light, the virus-infected, protoporphyrin-accumulated cells will be destroyed; and applying a sufficient dose of red light to the virus-infected, protoporphyrin-accumulated cells to destroy the virus-infected, protoporphyrin-accumulated cells.
    Type: Grant
    Filed: May 8, 1996
    Date of Patent: April 20, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: Ehud Ben-Hur, Zvi Malik
  • Patent number: 5876947
    Abstract: The invention provides monospecific antibodies that are specifically reactive with fibrinopeptide B (FPB) and with fibrinogen and fragments thereof containing the amino acid sequence defined by SEQ ID NO:1. The invention also provides anti-FPB probes, including monospecific anti-FPB antibodies that have been detectably labeled. In addition, the invention provides methods of using the monospecific antibodies for detection of fibrinopeptide B, as well as reagents and kits for performing the methods. For example, the invention provides a method for detecting fibrinopeptide B with specificity in biological samples such as blood samples, by using the antibody to immunometrically bind to the fibrinopeptide B. Diagnostic methods for determining information associated with atherogenesis and/or thrombogenesis. The invention further provides continuous cell lines (hybridomas) that produce monospecific anti-FPB antibodies.
    Type: Grant
    Filed: July 25, 1997
    Date of Patent: March 2, 1999
    Assignee: The New York Blood Center, Inc.
    Inventors: Bohdan J. Kudryk, Colvin M. Redman, Jian-Zhong Zhang
  • Patent number: 5858643
    Abstract: A red blood cell containing composition is presented which has reduced potassium ion leakage after irradiation in a virus photoinactivation process. The irradiated red blood cell containing composition comprises red blood cells, a photosensitizer, and sufficient vitamin E or derivatives thereof to prevent potassium leakage. Preferred photosensitizers are aluminum phthalocyanines, AlPcS.sub.4 or Pc5. A preferred vitamin E derivative is Trolox.
    Type: Grant
    Filed: May 12, 1997
    Date of Patent: January 12, 1999
    Assignee: New York Blood Center, Inc.
    Inventors: Ehud Ben-Hur, Shanti Rywkin, Bernard Horowitz
  • Patent number: 5830468
    Abstract: The invention provides a method of causing the degradation of fibrin(ogen) (i.e., fibrin, fibrinogen, and related substances) by means of a fibrinolytic metalloproteinase, such as MMP-3. The method of the invention may be performed in vitro to provide diagnostic information characterizing fibrin(ogen) and the fibrinolytic physiology. The method may also be performed in vivo as a method of thrombolytic therapy in which a fibrinolytic metalloproteinase is administered to a subject to degrade thrombus in situ. The invention further provides compositions containing a fibrinolytic metalloproteinase for the performance of fibrinolytic or thrombolytic procedures. Also provided are kits which include a fibrinolytic metalloproteinase for performing fibrinolytic or thrombolytic procedures.
    Type: Grant
    Filed: May 17, 1995
    Date of Patent: November 3, 1998
    Assignee: The New York Blood Center, Inc.
    Inventor: Alessandra Bini
  • Patent number: 5817768
    Abstract: The invention provides nonspecific antibodies which are specifically reactive with the .alpha..sub.E subunit of fibrinogen or a fragment thereof, but not with other portions of the fibrinogen molecule. The invention also provides anti-.alpha..sub.E probes, including nonspecific anti-.alpha..sub.E antibodies which have been detectably labeled. In addition, the invention provides methods of using the nonspecific antibodies for detection of the .alpha..sub.E subunit and fragments thereof, as well as reagents and kits for performing the methods. Diagnostic methods for determining information associated with atherogenesis and/or thrombogenesis, as well as for determining information associated with pregnancy status or outcome. The invention further provides continuous cell lines which produce monospecific anti-.alpha..sub.E antibodies.
    Type: Grant
    Filed: June 7, 1995
    Date of Patent: October 6, 1998
    Assignee: The New York Blood Center, Inc.
    Inventors: Gerd Grieninger, Yiping Fu, Yan Cao, Mohamad Zaher Ahadi, Bohdan J. Kudryk
  • Patent number: 5804379
    Abstract: The invention provides a diagnostic method of determining Kell genotype by the identification of the molecular basis of a Kell polymorphism. Specifically, the invention provides a method for determining K1/K2 genotype with great accuracy, overcoming problems associated with traditional serological typing methods. The diagnostic method of the invention preferably employs amplification of K1/K2 nucleic acid sequences, and optionally employs differential cleavage of K1- and K2-specific nucleic acid sequences by a restriction enzyme. Also provided are nucleic acid oligomers useful as probes or primers for the method of the invention. Furthermore, diagnostic kits for the determination of Kell genotype are provided.
    Type: Grant
    Filed: June 7, 1995
    Date of Patent: September 8, 1998
    Assignee: New York Blood Center, Inc.
    Inventors: Soohee Lee, Colvin M. Redman
  • Patent number: 5789150
    Abstract: An improvement in a process for inactivating extracellular and intracellular viruses in a platelet containing composition is presented. The improvement in the process comprises adding a sensitizer to the platelet containing composition and irradiating the composition containing the sensitizer with UVA1 in the absence of UVA2 for a period of time sufficient to inactivate the viruses while retaining the functionality of the platelet containing composition. A quencher or mixture of quenchers of type I and type II photodynamic reactions may be advantageously added to the composition prior to irradiation.
    Type: Grant
    Filed: October 3, 1996
    Date of Patent: August 4, 1998
    Assignee: New York Blood Center, Inc.
    Inventors: Henrietta Margolis-Nunno, Ehud Ben-Hur, Bernard Horowitz
  • Patent number: 5789147
    Abstract: A therapeutic product formed from a high concentration of white blood cells having a high degree of cell viability. The white blood cells are sequestered from their normal population presence in whole blood by placing the blood into a container and preventing coagulation of the blood, separating the blood into two components, one of which is extremely rich in white blood cells through the use of a reagent and centrifugation, sequestering the white cell concentration, and freezing the white cells.
    Type: Grant
    Filed: December 5, 1994
    Date of Patent: August 4, 1998
    Assignee: New York Blood Center, Inc.
    Inventors: Pablo Rubinstein, Philip Henry Coelho, Cladd E. Stevens
  • Patent number: 5759169
    Abstract: An applicator for dispensing a first and a second component of a biological adhesive, such as a fibrin sealant, wherein the applicator comprises a housing having a first dispensing conduit for dispensing the first component and a second dispensing conduit for dispensing the second component. A pressure supply conduit is in communication with the dispensing conduits and both a first reservoir containing the first component, and a second reservoir containing the second component. A first pressure regulator, also in communication with the first reservoir, controls the pressure supplied through the pressure supply conduit to the first reservoir and a second pressure regulator, also in communication with the second reservoir, controls the pressure supplied through the pressure supply conduit to the second reservoir.
    Type: Grant
    Filed: March 13, 1996
    Date of Patent: June 2, 1998
    Assignee: New York Blood Center Inc.
    Inventor: Gerard Marx