Patents Assigned to Sphingotec GmbH
  • Patent number: 12662530
    Abstract: Anti-adrenomedullin (ADM) antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for the treatment of a critically ill patients suffering from an acute disease or condition resulting in the accelerated the conversion of ADM-Gly to ADM-NH2 of circulating ADM-Gly in the patient. The patient has a ratio of pro-Adrenomedullin or a fragment thereof to ADM-NH2 above a predetermined threshold in a sample of bodily fluid. The pro-Adrenomedullin or fragment thereof is PAMP, MR-proADM, ADM-Gly or CT-proADM and the anti-ADM antibody or anti-ADM fragment or anti-ADM non-Ig scaffold binds to the N-terminal and/or mid-regional part (amino acid 1-42) of ADM-Gly and/or ADM-NH2: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVA.
    Type: Grant
    Filed: February 25, 2021
    Date of Patent: June 23, 2026
    Assignee: SPHINGOTEC GMBH
    Inventors: Andrea Sparwasser, Paul Kaufmann, Joachim Struck
  • Patent number: 12399186
    Abstract: A method for (a) diagnosing or monitoring kidney function in subject or (b) diagnosing kidney dysfunction in a subject or (c) predicting or monitoring the risk of an adverse events in a diseased subject or (d) predicting or monitoring the success of a therapy or intervention comprising determining the level of Pro-Enkephalin (PENK) or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said subject; and correlating said level of Pro-Enkephalin or fragments thereof with (a) kidney function in a subject or (b) kidney dysfunction in said subject or (c) enhanced risk of adverse events or (d) success of a therapy or intervention in a diseased subject.
    Type: Grant
    Filed: May 24, 2021
    Date of Patent: August 26, 2025
    Assignee: SPHINGOTEC GMBH
    Inventor: Andreas Bergmann
  • Patent number: 12247988
    Abstract: An in vitro method for therapy follow-up in septic patients wherein the concentration of mature ADM 1-52 and/or mature ADM 1-52-Gly in a sample of bodily fluid of said septic patient is determined using an assay containing two binders that bind to two different regions within the region of mature adrenomedullin and/or adrenomedullin-Gly that is amino acid 21-52-amid SEQ ID No. 1 or amino acid 21-52-Gly SEQ ID No. 2 wherein each of said regions contains at least 4 or 5 amino acids, and further assays and calibration methods.
    Type: Grant
    Filed: September 14, 2023
    Date of Patent: March 11, 2025
    Assignee: SPHINGOTEC GMBH
    Inventor: Andreas Bergmann
  • Patent number: 12228581
    Abstract: An in vitro method for therapy follow-up in septic patients wherein the concentration of mature ADM 1-52 and/or mature ADM 1-52-Gly in a sample of bodily fluid of said septic patient is determined using an assay containing two binders that bind to two different regions within the region of mature adrenomedullin and/or adrenomedullin-Gly that is amino acid 21-52-amid SEQ ID No. 1 or amino acid 21-52-Gly SEQ ID No. 2 wherein each of said regions contains at least 4 or 5 amino acids, and further assays and calibration methods.
    Type: Grant
    Filed: June 23, 2023
    Date of Patent: February 18, 2025
    Assignee: SPHINGOTEC GMBH
    Inventor: Andreas Bergmann
  • Publication number: 20240272178
    Abstract: Subject matter of the present invention is a method for predicting sepsis, severe sepsis or septic shock in a patient comprising determining the level of Pro-Tachykinin A or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said subject, and correlating the determined level of Pro-Tachykinin A or fragments thereof of at least 5 amino acids with sepsis or septic shock, wherein an elevated level above a certain threshold is predictive of sepsis, severe sepsis or septic shock.
    Type: Application
    Filed: June 17, 2022
    Publication date: August 15, 2024
    Applicant: SphingoTec GmbH
    Inventor: Andreas BERGMANN
  • Publication number: 20240255531
    Abstract: A method of selecting critically ill patients for treatment with corticosteroids, by determining the level of ADM-NH2 or fragment thereof in a sample of bodily fluid of the patient, comparing the level of ADM-NH2 or fragment thereof to a pre-determined threshold or to a previously measured level of ADM-NH2 or fragment thereof, and at a value above the threshold appointing a therapy with corticosteroids. A method for corticosteroid therapy guidance and/or stratification in critically ill patients by providing a sample of bodily fluid of the patient, and determining the level of ADM-NH2 or fragment thereof in the sample, and comparing the level of ADM-NH2 or fragment thereof to a pre-determined threshold or to a previously measured level of ADM-NH2 or fragment thereof, wherein the level of ADM-NH2 or fragments thereof is indicative of whether an initiation of a corticosteroid therapy is required.
    Type: Application
    Filed: May 6, 2022
    Publication date: August 1, 2024
    Applicant: SPHINGOTEC GMBH
    Inventors: Deborah BERGMANN, Florian UHLE
  • Publication number: 20240103021
    Abstract: An in vitro method for therapy follow-up in septic patients wherein the concentration of mature ADM 1-52 and/or mature ADM 1-52-Gly in a sample of bodily fluid of said septic patient is determined using an assay containing two binders that bind to two different regions within the region of mature adrenomedullin and/or adrenomedullin-Gly that is aminoacid 21-52-amid SEQ ID No. 1 or aminoacid 21-52-Gly SEQ ID No. 2 wherein each of said regions contains at least 4 or 5 amino acids, and further assays and calibration methods.
    Type: Application
    Filed: September 14, 2023
    Publication date: March 28, 2024
    Applicant: SPHINGOTEC GMBH
    Inventor: Andreas BERGMANN
  • Publication number: 20240085438
    Abstract: An in vitro method for therapy follow-up in septic patients wherein the concentration of mature ADM 1-52 and/or mature ADM 1-52-Gly in a sample of bodily fluid of said septic patient is determined using an assay containing two binders that bind to two different regions within the region of mature adrenomedullin and/or adrenomedullin-Gly that is aminoacid 21-52-amid SEQ ID No. 1 or aminoacid 21-52-Gly SEQ ID No. 2 wherein each of said regions contains at least 4 or 5 amino acids, and further assays and calibration methods.
    Type: Application
    Filed: June 23, 2023
    Publication date: March 14, 2024
    Applicant: SPHINGOTEC GMBH
    Inventor: Andreas BERGMANN
  • Patent number: 11844812
    Abstract: Subject of the present invention is a method for assessing a risk for getting a first cardiovascular event or assessing the risk for cardiovascular mortality in a subject, comprising: a) determining the level and/or the amount of Selenoprotein P and/or fragments thereof in a sample of said subject; b) correlating the determined level and/or the amount of Selenoprotein P and/or fragments thereof with the risk for getting a first cardiovascular event or assessing the risk for cardiovascular mortality in said subject.
    Type: Grant
    Filed: October 23, 2018
    Date of Patent: December 19, 2023
    Assignee: SPHINGOTEC GMBH
    Inventors: Andreas Bergmann, Olle Melander
  • Publication number: 20230357383
    Abstract: Anti-adrenomedullin (ADM) antibody or an anti-ADM antibody fragment or anti-ADM non-Ig scaffold for the treatment of a critically ill patients suffering from an acute disease or condition including: severe infections, meningitis, systemic inflammatory response syndrome, sepsis, shock, septic shock, cardiogenic shock, acute heart failure, acute decompensated heart failure, chronic heart failure with worsening signs and symptoms, myocardial infarction, stroke, organ dysfunction or dementia, in order to accelerate the conversion of ADM-Gly to ADM-NH2 of circulating ADM-Gly in the patient, which patient has a ratio of pro-Adrenomedullin or a fragment thereof to ADM-NH2 above a certain threshold in a sample of bodily fluid, wherein the pro-Adrenomedullin or fragment thereof is PAMP, MR-proADM, ADM-Gly or CT-proADM and wherein the anti-ADM antibody or anti-ADM fragment or anti-ADM non-Ig scaffold binds to the N-terminal and/or mid-regional part (amino acid 1-42) of ADM-Gly and/or ADM-NH2: YRQSMNNFQGLRSFGCRFGTCTVQKL
    Type: Application
    Filed: February 25, 2021
    Publication date: November 9, 2023
    Applicant: SphingoTec GmbH
    Inventors: Andrea SPARWASSER, Paul KAUFMANN, Joachim STRUCK
  • Patent number: 11726101
    Abstract: An in vitro method for therapy follow-up in septic patients wherein the concentration of mature ADM 1-52 and/or mature ADM 1-52-Gly in a sample of bodily fluid of said septic patient is determined using an assay containing two binders that bind to two different regions within the region of mature adrenomedullin and/or adrenomedullin-Gly that is aminoacid 21-52-amid SEQ ID No. 1 or aminoacid 21-52-Gly SEQ ID No. 2 wherein each of said regions contains at least 4 or 5 amino acids, and further assays and calibration methods.
    Type: Grant
    Filed: June 16, 2021
    Date of Patent: August 15, 2023
    Assignee: SPHINGOTEC GMBH
    Inventor: Andreas Bergmann
  • Publication number: 20230221339
    Abstract: Subject matter of the present invention is a method for diagnosing dementia, or determining the risk of getting dementia in a subject that does not have dementia, or monitoring therapy or monitoring or guiding intervention in a subject that has dementia, or monitoring therapy or monitoring or guiding preventive intervention in a subject that is at risk of getting dementia.
    Type: Application
    Filed: December 30, 2022
    Publication date: July 13, 2023
    Applicant: SPHINGOTEC GMBH
    Inventor: Olle MELANDER
  • Publication number: 20230147663
    Abstract: Subject matter of the present invention is a method for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject comprising: determining the level of Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin of at least 5 amino acids in a bodily fluid obtained from said female subject; and correlating said level of Pro-Enkephalin or fragments thereof with a risk for getting cancer, wherein a reduced level is predictive for an enhanced risk of getting cancer or alternatively diagnosing cancer wherein an reduced level is correlated with the diagnosis of cancer.
    Type: Application
    Filed: September 29, 2022
    Publication date: May 11, 2023
    Applicant: SPHINGOTEC GMBH
    Inventors: Andreas BERGMANN, Olle Melander
  • Publication number: 20230127440
    Abstract: The present invention relates to means and methods suitable for risk prediction of chronic kidney disease (CKD) using Pro-Enkephalin or fragments thereof as biomarker. The risk prediction methods of the invention are intended for healthy subjects and for subjects suffering from diseases such as hypertension, cardiovascular diseases and events, diabetes, metabolic syndrome, obesity, or autoimmune diseases. Subject matter of the invention is also a method of predicting the worsening or improvement of kidney function or dysfunction in healthy and diseased individuals.
    Type: Application
    Filed: November 14, 2022
    Publication date: April 27, 2023
    Applicant: Sphingotec GmbH
    Inventors: Andreas BERGMANN, Olle MELANDER
  • Patent number: 11598781
    Abstract: The present invention relates to means and methods suitable for risk prediction of chronic kidney disease (CKD) using Pro-Enkephalin or fragments thereof as biomarker. The risk prediction methods of the invention are intended for healthy subjects and for subjects suffering from diseases such as hypertension, cardiovascular diseases and events, diabetes, metabolic syndrome, obesity, or autoimmune diseases. Subject matter of the invention is also a method of predicting the worsening or improvement of kidney function or dysfunction in healthy and diseased individuals.
    Type: Grant
    Filed: April 21, 2016
    Date of Patent: March 7, 2023
    Assignee: Sphingotec GmbH
    Inventors: Andreas Bergmann, Olle Melander
  • Publication number: 20220291234
    Abstract: (a) diagnosing or monitoring kidney function in a subject or (b) diagnosing kidney dysfunction in a subject or (c) predicting or monitoring the risk of an adverse event in a diseased subject, wherein said adverse event is selected from the group comprising worsening of kidney function including kidney failure, loss of kidney function and end-stage kidney disease or death due to kidney dysfunction including kidney failure, loss of kidney function and end-stage kidney disease or (d) predicting or monitoring the success of a therapy or intervention: determining the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said subject; and correlating said level of Pro-Enkephalin or fragments thereof with kidney function in a subject.
    Type: Application
    Filed: August 14, 2020
    Publication date: September 15, 2022
    Applicant: SPHINGOTEC GMBH
    Inventors: Andreas BERGMANN, Saskia DE WILDT
  • Patent number: 11340240
    Abstract: A method for determining the fat processing activity and/or predicting the risk of obesity in a subject involves determining the level of pro-neurotensin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from the subject, and correlating the level of pro-neurotensin or fragments thereof with fat processing activity and/or the risk of incidence of obesity in the subject. An elevated level is indicative of enhanced fat processing activity and/or predictive for an enhanced risk of getting obesity.
    Type: Grant
    Filed: July 17, 2020
    Date of Patent: May 24, 2022
    Assignee: SPHINGOTEC GMBH
    Inventors: Andreas Bergmann, Olle Melander
  • Publication number: 20220043005
    Abstract: A method for assessing risk in a subject having heart failure that is (i) risk for getting a cardiovascular event and/or (ii) risk of worsening heart failure condition and/or (iii) assessing risk for mortality, and/or (iv) assessing risk of hospitalization or re-hospitalization due to heart failure, involves: a) determining the level and/or amount of Selenoprotein P and/or fragments thereof in a sample from the subject, b) correlating the determined level and/or the amount of Selenoprotein P and/or fragments thereof in a subject having heart failure with one or more of the risks (i) to (iv) mentioned above. Subject matter of the present invention includes stratification of patients and treatment methods for heart failure patients at high risk (i) for getting a cardiovascular event and/or (ii) of worsening heart failure condition and/or (iii) for mortality, in particular cardiovascular mortality, and/or (iv) of hospitalisation or re-hospitalisation due to heart failure.
    Type: Application
    Filed: December 20, 2019
    Publication date: February 10, 2022
    Applicant: SPHINGOTEC GMBH
    Inventors: Andreas BERGMANN, Olle MELANDER, Martin MAGNUSSON
  • Publication number: 20210333292
    Abstract: A method for (a) diagnosing or monitoring kidney function in subject or (b) diagnosing kidney dysfunction in a subject or (c) predicting or monitoring the risk of an adverse events in a diseased subject or (d) predicting or monitoring the success of a therapy or intervention comprising determining the level of Pro-Enkephalin (PENK) or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said subject; and correlating said level of Pro-Enkephalin or fragments thereof with (a) kidney function in a subject or (b) kidney dysfunction in said subject or (c) enhanced risk of adverse events or (d) success of a therapy or intervention in a diseased subject.
    Type: Application
    Filed: May 24, 2021
    Publication date: October 28, 2021
    Applicant: SPHINGOTEC GMBH
    Inventor: Andreas BERGMANN
  • Publication number: 20210311078
    Abstract: Subject of the present invention is an in vitro method for therapy follow-up in septic patients wherein the concentration of mature ADM 1-52 and/or mature ADM 1-52-Gly in a sample of bodily fluid of said septic patient is determined using an assay comprising two binders that bind to two different regions within the region of mature adrenomedullin and/or adrenomedullin-Gly that is amino acid 21-52-amid SEQ ID No. 1 or amino acid 21-52-Gly SEQ ID No. 2 wherein each of said regions comprises at least 4 or 5 amino acids. The invention further relates to assays and calibration methods.
    Type: Application
    Filed: June 16, 2021
    Publication date: October 7, 2021
    Applicant: SPHINGOTEC GMBH
    Inventor: Andreas BERGMANN