Patents Assigned to SUZHOU UNIVERSITY
-
Patent number: 12352585Abstract: The present disclosure discloses a park-and-ride route generation method, a system, a device, and a medium. The method comprises: expanding an expanded network node from a starting position to a destination position in the constructed topological relationship between a roadway network and a public transportation network; obtaining, by using a multivariate heuristic function, a minimum cost value from the starting position to the destination position via the expanded network node; and generating a park-and-ride route from the starting position to the destination position according to the minimum cost value. The present disclosure realizes the self-adaptive switching between the roadway network and the public transportation network at the P&R parking lot, and meets the demand for hybrid travel mode involving the roadway network and the public transportation network.Type: GrantFiled: November 21, 2024Date of Patent: July 8, 2025Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventor: Yan Feng
-
Publication number: 20250188939Abstract: Water pumps for an urban water landscape, including a water pump main body, a water pump base, a grille net cover, and a filter component. The water pump main body includes a water pump shell. A water outlet interface is disposed on a top of the water pump shell. The grille net cover is located on a front side of the water pump shell. The grille net cover is fixedly connected to the water pump shell through a filter component pallet on a bottom of the grille net cover and filter component cross bars on two sides of the grille net cover. Two filter assemblies are inserted in series in the filter component slot. The water pump main body is detachably disposed on the water pump base.Type: ApplicationFiled: February 23, 2025Publication date: June 12, 2025Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Rundong LIU, Dapeng LI, Feiyue QIAN
-
Patent number: 12258969Abstract: Water pumps for an urban water landscape, including a water pump main body, a water pump base, a grille net cover, and a filter component. The water pump main body may include a water pump shell. A water outlet interface may be disposed on a top of the water pump shell. The grille net cover may be located on a front side of the water pump shell. The grille net cover may be fixedly connected to the water pump shell through a filter component pallet on a bottom of the grille net cover and filter component cross bars on two sides of the grille net cover. Two filter assemblies may be inserted in series in the filter component slot. The water pump main body may be detachably disposed on the water pump base.Type: GrantFiled: March 9, 2023Date of Patent: March 25, 2025Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Rundong Liu, Dapeng Li, Feiyue Qian, Congpei Li, Kaiwei Feng
-
Patent number: 12102960Abstract: The present disclosure discloses a plasma purification device for purifying catering oil fume and a method for purifying catering oil fume, relating to the technical field of atmospheric pollution control. The plasma purification device successively includes in a flow direction of airflow an inlet, a rotary discharge module configured to negatively charge oil fume particulate matter with a particle size between 2 ?m and 50 ?m in the catering oil fume; an electrostatic adsorption module configured to capture negatively charged oil fume particulate matter; a back corona catalytic module configured to treat VOCs in the catering oil fume; and an outlet. The rotary discharge module includes a central rod arranged parallel to the flow direction of airflow and a plurality of barbed corona electrodes arranged around the central rod.Type: GrantFiled: July 19, 2023Date of Patent: October 1, 2024Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Xing Zhang, Yubin Chi
-
Publication number: 20240175449Abstract: The embodiments of the present disclosure provide water pumps for an urban water landscape, comprising a water pump main body, a water pump base, a grille net cover, and a filter component. The water pump main body may include a water pump shell. A water outlet interface may be disposed on a top of the water pump shell. The grille net cover may be located on a front side of the water pump shell. The grille net cover may be fixedly connected to the water pump shell through a filter component pallet on a bottom of the grille net cover and filter component cross bars on two sides of the grille net cover. Two filter assemblies may be inserted in series in the filter component slot. The water pump main body may be detachably disposed on the water pump base.Type: ApplicationFiled: March 9, 2023Publication date: May 30, 2024Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Rundong LIU, Dapeng LI, Feiyue QIAN, Congpei LI, Kaiwei FENG
-
Publication number: 20240131207Abstract: A nuclide-labeled inhibitory peptide, and a preparation method therefor and use thereof are provided. The nuclide-labeled inhibitory peptide is prepared by labeling ASF1a peptide with 68Ga/177Lu by DOTA, and an amino acid sequence of the ASF1a peptide is YGRKKRRQRRRCASTEEKWARLARRIAGAGGVTLDGFGGCA (as shown in SEQ ID NO: 1). The 68Ga labeled ASF1a inhibitory peptide of the present invention displays the expression level of ASF1a of a tumor through PET/CT imaging, has good imaging sensitivity, can specifically screen high-expression and low-expression individuals, and achieves noninvasive prediction of the efficacy of tumor immunotherapy. The 177Lu-labeled ASF1a inhibitory peptide provides a novel and effective therapeutic strategy for a tumor that highly expresses ASF1a and is not effective for immunotherapy.Type: ApplicationFiled: November 16, 2023Publication date: April 25, 2024Applicant: SUZHOU UNIVERSITYInventors: Kai YANG, Xiumin SHI
-
Patent number: 11952299Abstract: The disclosure relates to the technical field of energy saving and consumption reduction, and in particular, to a gas-liquid recycling device. A gas-liquid recycling device and a method of using same provided by the disclosure includes a gas-collection hood, a gas delivery pipe and a liquid delivery pipe. A gas inlet port of the gas delivery pipe is connected to the gas collection hood, a gas outlet port of the gas delivery pipe is inserted into a liquid outlet port of the liquid delivery pipe, and a liquid inlet port is located at an end of the liquid delivery pipe opposite to the liquid outlet port.Type: GrantFiled: January 14, 2021Date of Patent: April 9, 2024Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Xiang Li, Yan Yuan, Yong Huang
-
Patent number: 11840463Abstract: Disclosed are a device and a method for advanced water treatment, and the device comprises a plate-and-frame membrane reactor having a water inlet pipe and a water outlet pipe, a raw water delivery system communicating with the water inlet pipe of the plate-and-frame membrane reactor, and a clear water reservoir communicating with the water outlet pipe of the plate-and-frame membrane reactor; the advanced water treatment device further comprises an oxidant dosing system communicating with the water inlet pipe of the plate-and-frame membrane reactor or the raw water delivery system, the plate-and-frame membrane reactor further comprises a carbon nano-material composite membrane, the carbon nano-material composite membrane comprises carbon nano-material layers sequentially disposed between the water inlet pipe and the water outlet pipe, and a base membrane layer supporting the carbon nano-material layers, and the raw material of the carbon nano-material layers comprises mono-layer reduced graphene oxide and mulType: GrantFiled: August 1, 2019Date of Patent: December 12, 2023Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Feiyue Qian, Shiqian Gao, Junxia Wang
-
Patent number: 11809485Abstract: A method for retrieving footprint images is provided, comprising: pre-training models; cleaning footprint data and conducting expansion pre-processing by using the pre-trained models, dividing the footprint data into multiple data sets; adjusting full connection layers and classification layers of the models; training the models again by using the data sets through the parameters of the pre-trained models; saving the models trained twice, removing the classification layer, executing a feature extraction for images in an image library and a retrieval library to form a feature index library; connecting the features extracted by three models to form fused features, establishing a fused feature vector index library; extracting the features of the images in the image library to be retrieved in advance, and establishing a feature vector library; calculating distances in the retrieval library and the image library when a single footprint image is inputted, thereby outputting the image with the highest similarity.Type: GrantFiled: November 25, 2020Date of Patent: November 7, 2023Assignees: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGY, KUNSHAN PUBLIC SECURITY BUREAUInventors: Xuefeng Xi, Yang Chen, Cheng Zeng, Qian Zhang, Cheng Cheng, Baochuan Fu, Zhiming Cui
-
Publication number: 20230271864Abstract: A process for enriching phosphorus and recovering vivianite by a biofilm method includes the following steps: 1) an aerobic phosphorus absorption stage; 2) an anaerobic phosphorus release stage; 3) a cyclic enrichment stage; 4) a seed crystal forming stage; and 5) a crystal forming stage.Type: ApplicationFiled: May 24, 2021Publication date: August 31, 2023Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Yang PAN, Xingyu ZHANG, Yong HANG, Min NI, Yue CHEN
-
Publication number: 20220411299Abstract: The disclosure relates to the technical field of energy saving and consumption reduction, and in particular, to a gas-liquid recycling device. A gas-liquid recycling device and a method of using same provided by the disclosure includes a gas-collection hood, a gas delivery pipe and a liquid delivery pipe. A gas inlet port of the gas delivery pipe is connected to the gas collection hood, a gas outlet port of the gas delivery pipe is inserted into a liquid outlet port of the liquid delivery pipe, and a liquid inlet port is located at an end of the liquid delivery pipe opposite to the liquid outlet port.Type: ApplicationFiled: January 14, 2021Publication date: December 29, 2022Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Xiang LI, Yan YUAN, Yong HUANG
-
Patent number: 11479491Abstract: The present disclosure relates to an integrated wastewater treatment apparatus and method, the apparatus comprises a first reactor module, a second reactor module, a sedimentation module and a gas-liquid separation module, the first reactor module comprises a first reactor and an anoxic reaction zone, an aerobic reaction zone, a first gas-gathering pressurized layer, a first water inlet pipe and an aeration device; the second reactor module comprises a second reactor, a second water inlet pipe, an anaerobic reaction zone and a second gas-gathering pressurized layer; the sedimentation module comprises a third reactor and a water outlet pipe; the gas-liquid separation module comprises a gas-liquid separator, an exhaust pipe, a first riser pipe, a second riser pipe and a return pipe. The apparatus can give full play to the advantages of the autotrophic biological denitrification process, meet the biochemical treatment requirements of wastewater with low C/N ratio.Type: GrantFiled: November 11, 2021Date of Patent: October 25, 2022Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Feng Liu, Feiyue Qian, Yong Li, Suqin Wang, Jianhua Wu
-
Publication number: 20220100793Abstract: A method for retrieving footprint images is provided, comprising: pre-training models; cleaning footprint data and conducting expansion pre-processing by using the pre-trained models, dividing the footprint data into multiple data sets; adjusting full connection layers and classification layers of the models; training the models again by using the data sets through the parameters of the pre-trained models; saving the models trained twice, removing the classification layer, executing a feature extraction for images in an image library and a retrieval library to form a feature index library; connecting the features extracted by three models to form fused features, establishing a fused feature vector index library; extracting the features of the images in the image library to be retrieved in advance, and establishing a feature vector library; calculating distances in the retrieval library and the image library when a single footprint image is inputted, thereby outputting the image with the highest similarity.Type: ApplicationFiled: November 25, 2020Publication date: March 31, 2022Applicants: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGY, KUNSHAN PUBLIC SECURITY BUREAUInventors: Xuefeng XI, Yang CHEN, Cheng ZENG, Qian ZHANG, Cheng CHENG, Baochuan FU, Zhiming CUI
-
Publication number: 20210276000Abstract: The present invention provides a preparation method of a photocatalytic composite material, and relates to the field of catalyst technologies. The preparation method provided in the present invention includes the following steps: (1) subjecting plant leaves to soaking pretreatment to obtain template biomass; (2) mixing a molybdenum source-sulfur source aqueous solution with the template biomass obtained in step (1) and conducting impregnation to obtain a composite material precursor; and (3) calcining the composite material precursor obtained in step (2) to obtain the photocatalytic composite material. The photocatalytic composite material in the present invention includes acicular molybdenum sulfide and biomass carbon, the acicular molybdenum sulfide is loaded to a surface of the flake carbon, the mass content of the biomass carbon is 70% to 90%, and the mass content of the molybdenum sulfide is 10% to 30%.Type: ApplicationFiled: July 30, 2018Publication date: September 9, 2021Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Zhigang CHEN, Feng CHEN, Junchao QIAN, Chengbao LIU, Chencheng WANG
-
Patent number: 10429567Abstract: A multi-view pixel directional backlight module and a naked-eye 3D display device are provided. The multi-view pixel directional backlight module includes at least two rectangular light guide plates closely stacked together. A light-emerging surface of the rectangular light guide plate is provided with multiple pixel arrays. Light emitted by pixels in a same pixel array is pointed to a same viewing angle, and different pixel arrays have different viewing angles. At least one side of each rectangular light guide plate is provided with a light source group. Light emitted by the light source group enters the corresponding light guide plate, then emerges from pixels of respective pixel arrays on the light-emerging surface of the light guide plate, and is totally reflected at positions other than positions of the pixels within the light guide plate. Each of the pixels is a nano-diffraction grating.Type: GrantFiled: March 30, 2015Date of Patent: October 1, 2019Assignees: SUZHOU UNIVERSITY, SUZHOU SVG OPTRONICS TECHNOLOGY CO., LTDInventors: Wenqiang Wan, Linsen Chen, Yimin Lou, Donglin Pu, Ming Zhu, Pengfei Zhu, Su Shen, Yan Ye
-
Publication number: 20140233126Abstract: A reflective color filter comprises a medium grating layer (220), a metal layer (230), and a first medium layer (240). The metal layer is provided on the ridge portion, at least one side portion, and a part of the groove portion of the medium grating layer. The first medium layer reflecting outside light is provided on the medium grating layer and the metal layer. Because a part of the medium grating layer is exposed through an opening of the metal layer on the groove portion, the angular sensitivity of the resonance output is reduced, and the influence of the incident angle on the resonance condition is diminished. Therefore, a reflection filtering can be realized in a wide angular area.Type: ApplicationFiled: May 31, 2011Publication date: August 21, 2014Applicants: SUZHOU UNIVERSITY, SVG OPTRONICS, CO. LTD.Inventors: Yan Ye, Linsen Chen
-
Publication number: 20120092196Abstract: A method for inputting text using the keys of 0-9 of a numeric keypad. The code length of digital encoding may be from 4 to 5 bits. For Chinese-characters, the total number of strokes expressed by two figures may correspond to the first two bits, the first three stroke codes may correspond to the third to the fifth bits, respectively, and inputting the termination code when the total code length is less than 5 bits. For letters, figures, and symbols, two bits express the serial number, the third bit is an identification code, and the fourth bit is the termination code, Chinese-characters and other characters may be inputted with the same input method without switching the input state. The probability of repeated codes is low. The methods can be used by various kinds of input devices with numeric keys.Type: ApplicationFiled: September 23, 2011Publication date: April 19, 2012Applicant: SUZHOU UNIVERSITYInventors: Hong WANG, Jiming WU
-
Publication number: 20090297587Abstract: An improved hydrogel wound dressing and its preparation is disclosed. The ingredients used in the dressing are PAAS of 20˜30 wt %, PVA of 2˜6 wt % and water of 64˜78 wt %. The hydrogel wound dressings were formed by dissolution, casting films, radiation synthesis and sterilization. Compared with conventional hydrogel dressings the improved dressings displayed an enhanced degree of swelling. Cell growth factors may be incorporated into the dressings to be released slowly in the wound.Type: ApplicationFiled: May 22, 2009Publication date: December 3, 2009Applicant: SUZHOU UNIVERSITYInventors: Zhanshan Yang, Zhigao Rao, Ling Yue, Shuqin Yang, Nankang Zhu