Patents Assigned to SUZHOU UNIVERSITY
-
Patent number: 12258969Abstract: Water pumps for an urban water landscape, including a water pump main body, a water pump base, a grille net cover, and a filter component. The water pump main body may include a water pump shell. A water outlet interface may be disposed on a top of the water pump shell. The grille net cover may be located on a front side of the water pump shell. The grille net cover may be fixedly connected to the water pump shell through a filter component pallet on a bottom of the grille net cover and filter component cross bars on two sides of the grille net cover. Two filter assemblies may be inserted in series in the filter component slot. The water pump main body may be detachably disposed on the water pump base.Type: GrantFiled: March 9, 2023Date of Patent: March 25, 2025Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Rundong Liu, Dapeng Li, Feiyue Qian, Congpei Li, Kaiwei Feng
-
Patent number: 12191800Abstract: The present invention provides an automatic solar tracking photovoltaic power generation device, comprising a box body and a solar panel arranged above the box body. The bottom of the solar panel is equipped with a continuously adjustable component. Inside the box body, there are interconnected worm gear and worm components, and a gear transmission component. The worm gear and worm components are connected to the continuously adjustable component. The present invention solves the problems of existing devices, such as single-direction adjustment and low collection efficiency. It automatically tracks the sun in both latitude and longitude directions, with continuous adjustment. During normal operation, no manual intervention is required. It is easy to use, with a self-locking structure, minimal impact from wind loads, and self-reporting of faults.Type: GrantFiled: March 7, 2024Date of Patent: January 7, 2025Assignees: Suzhou University of Science and Technology, Suzhou Vacational UniversityInventors: Siyuan Bao, Yongkang Zhang, Yun Zhong
-
Publication number: 20240418656Abstract: The present disclosure provides a colorimetric nanosensor for detecting trace-levels of Hg2+ in environmental water, which is composed of Fe7S8 nanosheets, glutathione or its aqueous solution, 3,3?,5,5?-tetramethylbenzidine colorimetric solution, H2O2 aqueous solution, and NaAc-Hac buffer. The preparation method of Fe7S8 nanosheets is as follows: FeCl2·4H2O and CH4N2S are dissolved in ethylene glycol in a mass ratio of (2˜3):1, heated at 200° C. for 10˜15 hours, cooled, centrifuged, washed, and dried to obtain. The colorimetric nanosensor of the present disclosure can quickly and sensitively determine the trace-levels Hg2+ in environmental water. The colorimetric nanosensor of the present disclosure does not rely on large detection instruments, and the nanozymes used is low-cost, stable, and recyclable. It has important practical significance for accurate, fast, and low-cost detection of trace-levels of Hg2+ in environmental water.Type: ApplicationFiled: August 30, 2024Publication date: December 19, 2024Applicant: Suzhou University of Science and TechnologyInventors: Tingting Liu, Xuedong Wang, Huili Wang, Ming Gao, Binrong Li, Chunyang Chen, Junxia Wang
-
Publication number: 20240382930Abstract: The present disclosure relates to a polyindole-montmorillonite (Pind-mmt) complex and a preparation method and application thereof. The preparation method includes the following steps: subjecting mmt to cation saturation using ferric chloride, to prepare ferric ion-exchanged montmorillonite (Fe3+-mmt); and formulating an indole aqueous solution; adding Fe3+-mmt to the indole aqueous solution to enable indole molecules to generate Pind at mmt interlayer by in-situ polymerization, and obtaining a Pind-mmt complex body; and subjecting the Pind-mmt complex body to organic modification with quaternary ammonium salt cationic surfactant to obtain the Pind-mmt complex.Type: ApplicationFiled: May 6, 2024Publication date: November 21, 2024Applicant: Suzhou University of Science and TechnologyInventors: Haoting TIAN, Xiaohui YANG
-
Publication number: 20240382939Abstract: The present disclosure relates to a degradation method of a perfluoroalkyl substance (PFAS). The degradation method includes the following steps: polymerizing indole to synthesize pind; and mixing synthesized pind with the PFAS to form a mixed solution, and illuminating the formed mixed solution to allow pind to generate hydrated electrons (eaq?) for degrading the PFAS. In the degradation method of the present disclosure, indole with a high yield of hydrated electrons is polymerized to generate pind, and pind is used as a precursor for the generation of the hydrated electrons to increase the stability of a molecular structure of pind through a highly conjugated structure formed after polymerization, thereby achieving the purpose of continuously generating the hydrated electrons under ultraviolet irradiation and effectively degrading PFASs, which is of great significance for addressing the environmental pollution problem of PFASs.Type: ApplicationFiled: May 6, 2024Publication date: November 21, 2024Applicant: Suzhou University of Science and TechnologyInventors: Haoting TIAN, Xiaohui YANG
-
Patent number: 12102960Abstract: The present disclosure discloses a plasma purification device for purifying catering oil fume and a method for purifying catering oil fume, relating to the technical field of atmospheric pollution control. The plasma purification device successively includes in a flow direction of airflow an inlet, a rotary discharge module configured to negatively charge oil fume particulate matter with a particle size between 2 ?m and 50 ?m in the catering oil fume; an electrostatic adsorption module configured to capture negatively charged oil fume particulate matter; a back corona catalytic module configured to treat VOCs in the catering oil fume; and an outlet. The rotary discharge module includes a central rod arranged parallel to the flow direction of airflow and a plurality of barbed corona electrodes arranged around the central rod.Type: GrantFiled: July 19, 2023Date of Patent: October 1, 2024Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Xing Zhang, Yubin Chi
-
Publication number: 20240175449Abstract: The embodiments of the present disclosure provide water pumps for an urban water landscape, comprising a water pump main body, a water pump base, a grille net cover, and a filter component. The water pump main body may include a water pump shell. A water outlet interface may be disposed on a top of the water pump shell. The grille net cover may be located on a front side of the water pump shell. The grille net cover may be fixedly connected to the water pump shell through a filter component pallet on a bottom of the grille net cover and filter component cross bars on two sides of the grille net cover. Two filter assemblies may be inserted in series in the filter component slot. The water pump main body may be detachably disposed on the water pump base.Type: ApplicationFiled: March 9, 2023Publication date: May 30, 2024Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Rundong LIU, Dapeng LI, Feiyue QIAN, Congpei LI, Kaiwei FENG
-
Publication number: 20240131207Abstract: A nuclide-labeled inhibitory peptide, and a preparation method therefor and use thereof are provided. The nuclide-labeled inhibitory peptide is prepared by labeling ASF1a peptide with 68Ga/177Lu by DOTA, and an amino acid sequence of the ASF1a peptide is YGRKKRRQRRRCASTEEKWARLARRIAGAGGVTLDGFGGCA (as shown in SEQ ID NO: 1). The 68Ga labeled ASF1a inhibitory peptide of the present invention displays the expression level of ASF1a of a tumor through PET/CT imaging, has good imaging sensitivity, can specifically screen high-expression and low-expression individuals, and achieves noninvasive prediction of the efficacy of tumor immunotherapy. The 177Lu-labeled ASF1a inhibitory peptide provides a novel and effective therapeutic strategy for a tumor that highly expresses ASF1a and is not effective for immunotherapy.Type: ApplicationFiled: November 16, 2023Publication date: April 25, 2024Applicant: SUZHOU UNIVERSITYInventors: Kai YANG, Xiumin SHI
-
Patent number: 11952299Abstract: The disclosure relates to the technical field of energy saving and consumption reduction, and in particular, to a gas-liquid recycling device. A gas-liquid recycling device and a method of using same provided by the disclosure includes a gas-collection hood, a gas delivery pipe and a liquid delivery pipe. A gas inlet port of the gas delivery pipe is connected to the gas collection hood, a gas outlet port of the gas delivery pipe is inserted into a liquid outlet port of the liquid delivery pipe, and a liquid inlet port is located at an end of the liquid delivery pipe opposite to the liquid outlet port.Type: GrantFiled: January 14, 2021Date of Patent: April 9, 2024Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Xiang Li, Yan Yuan, Yong Huang
-
Patent number: 11840463Abstract: Disclosed are a device and a method for advanced water treatment, and the device comprises a plate-and-frame membrane reactor having a water inlet pipe and a water outlet pipe, a raw water delivery system communicating with the water inlet pipe of the plate-and-frame membrane reactor, and a clear water reservoir communicating with the water outlet pipe of the plate-and-frame membrane reactor; the advanced water treatment device further comprises an oxidant dosing system communicating with the water inlet pipe of the plate-and-frame membrane reactor or the raw water delivery system, the plate-and-frame membrane reactor further comprises a carbon nano-material composite membrane, the carbon nano-material composite membrane comprises carbon nano-material layers sequentially disposed between the water inlet pipe and the water outlet pipe, and a base membrane layer supporting the carbon nano-material layers, and the raw material of the carbon nano-material layers comprises mono-layer reduced graphene oxide and mulType: GrantFiled: August 1, 2019Date of Patent: December 12, 2023Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Feiyue Qian, Shiqian Gao, Junxia Wang
-
Patent number: 11833491Abstract: The present disclosure provides a synthesis method of a g-C3N4/C composite material based on a hollyhock stalk, including the following steps: (1) pretreatment of hollyhock stalks; and (2) fabrication of the g-C3N4/C composite material. In this method, with the hollyhock stalk as a carbon skeleton, g-C3N4 is spread on a template surface to form a laminated layer, and a composite system with a special structure is constructed. Compared with pure phase g-C3N4, the composite material substantially increases specific surface area and has a clear interface; the carbon skeleton not only functions as a rigid support, but also increases the electron transfer efficiency of the composite material, thereby improving the separation efficiency of photogenerated carriers and the utilization rate of visible light.Type: GrantFiled: July 18, 2022Date of Patent: December 5, 2023Assignee: Suzhou University of Science and TechnologyInventors: Chengbao Liu, Fei Tang, Tao Jin, Feng Chen, Junchao Qian, Zhigang Chen
-
Patent number: 11809485Abstract: A method for retrieving footprint images is provided, comprising: pre-training models; cleaning footprint data and conducting expansion pre-processing by using the pre-trained models, dividing the footprint data into multiple data sets; adjusting full connection layers and classification layers of the models; training the models again by using the data sets through the parameters of the pre-trained models; saving the models trained twice, removing the classification layer, executing a feature extraction for images in an image library and a retrieval library to form a feature index library; connecting the features extracted by three models to form fused features, establishing a fused feature vector index library; extracting the features of the images in the image library to be retrieved in advance, and establishing a feature vector library; calculating distances in the retrieval library and the image library when a single footprint image is inputted, thereby outputting the image with the highest similarity.Type: GrantFiled: November 25, 2020Date of Patent: November 7, 2023Assignees: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGY, KUNSHAN PUBLIC SECURITY BUREAUInventors: Xuefeng Xi, Yang Chen, Cheng Zeng, Qian Zhang, Cheng Cheng, Baochuan Fu, Zhiming Cui
-
Publication number: 20230271864Abstract: A process for enriching phosphorus and recovering vivianite by a biofilm method includes the following steps: 1) an aerobic phosphorus absorption stage; 2) an anaerobic phosphorus release stage; 3) a cyclic enrichment stage; 4) a seed crystal forming stage; and 5) a crystal forming stage.Type: ApplicationFiled: May 24, 2021Publication date: August 31, 2023Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Yang PAN, Xingyu ZHANG, Yong HANG, Min NI, Yue CHEN
-
Publication number: 20220411299Abstract: The disclosure relates to the technical field of energy saving and consumption reduction, and in particular, to a gas-liquid recycling device. A gas-liquid recycling device and a method of using same provided by the disclosure includes a gas-collection hood, a gas delivery pipe and a liquid delivery pipe. A gas inlet port of the gas delivery pipe is connected to the gas collection hood, a gas outlet port of the gas delivery pipe is inserted into a liquid outlet port of the liquid delivery pipe, and a liquid inlet port is located at an end of the liquid delivery pipe opposite to the liquid outlet port.Type: ApplicationFiled: January 14, 2021Publication date: December 29, 2022Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Xiang LI, Yan YUAN, Yong HUANG
-
Patent number: 11479491Abstract: The present disclosure relates to an integrated wastewater treatment apparatus and method, the apparatus comprises a first reactor module, a second reactor module, a sedimentation module and a gas-liquid separation module, the first reactor module comprises a first reactor and an anoxic reaction zone, an aerobic reaction zone, a first gas-gathering pressurized layer, a first water inlet pipe and an aeration device; the second reactor module comprises a second reactor, a second water inlet pipe, an anaerobic reaction zone and a second gas-gathering pressurized layer; the sedimentation module comprises a third reactor and a water outlet pipe; the gas-liquid separation module comprises a gas-liquid separator, an exhaust pipe, a first riser pipe, a second riser pipe and a return pipe. The apparatus can give full play to the advantages of the autotrophic biological denitrification process, meet the biochemical treatment requirements of wastewater with low C/N ratio.Type: GrantFiled: November 11, 2021Date of Patent: October 25, 2022Assignee: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Feng Liu, Feiyue Qian, Yong Li, Suqin Wang, Jianhua Wu
-
Patent number: 11351532Abstract: The present invention provides a preparation method of a photocatalytic composite material, and relates to the field of catalyst technologies. The preparation method provided in the present invention includes the following steps: (1) subjecting plant leaves to soaking pretreatment to obtain template biomass; (2) mixing a molybdenum source-sulfur source aqueous solution with the template biomass obtained in step (1) and conducting impregnation to obtain a composite material precursor; and (3) calcining the composite material precursor obtained in step (2) to obtain the photocatalytic composite material. The photocatalytic composite material in the present invention includes acicular molybdenum sulfide and biomass carbon, the acicular molybdenum sulfide is loaded to a surface of the flake carbon, the mass content of the biomass carbon is 70% to 90%, and the mass content of the molybdenum sulfide is 10% to 30%.Type: GrantFiled: July 30, 2018Date of Patent: June 7, 2022Assignee: Suzhou University Of Science And TechnologyInventors: Zhigang Chen, Feng Chen, Junchao Qian, Chengbao Liu, Chencheng Wang
-
Publication number: 20220100793Abstract: A method for retrieving footprint images is provided, comprising: pre-training models; cleaning footprint data and conducting expansion pre-processing by using the pre-trained models, dividing the footprint data into multiple data sets; adjusting full connection layers and classification layers of the models; training the models again by using the data sets through the parameters of the pre-trained models; saving the models trained twice, removing the classification layer, executing a feature extraction for images in an image library and a retrieval library to form a feature index library; connecting the features extracted by three models to form fused features, establishing a fused feature vector index library; extracting the features of the images in the image library to be retrieved in advance, and establishing a feature vector library; calculating distances in the retrieval library and the image library when a single footprint image is inputted, thereby outputting the image with the highest similarity.Type: ApplicationFiled: November 25, 2020Publication date: March 31, 2022Applicants: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGY, KUNSHAN PUBLIC SECURITY BUREAUInventors: Xuefeng XI, Yang CHEN, Cheng ZENG, Qian ZHANG, Cheng CHENG, Baochuan FU, Zhiming CUI
-
Publication number: 20210276000Abstract: The present invention provides a preparation method of a photocatalytic composite material, and relates to the field of catalyst technologies. The preparation method provided in the present invention includes the following steps: (1) subjecting plant leaves to soaking pretreatment to obtain template biomass; (2) mixing a molybdenum source-sulfur source aqueous solution with the template biomass obtained in step (1) and conducting impregnation to obtain a composite material precursor; and (3) calcining the composite material precursor obtained in step (2) to obtain the photocatalytic composite material. The photocatalytic composite material in the present invention includes acicular molybdenum sulfide and biomass carbon, the acicular molybdenum sulfide is loaded to a surface of the flake carbon, the mass content of the biomass carbon is 70% to 90%, and the mass content of the molybdenum sulfide is 10% to 30%.Type: ApplicationFiled: July 30, 2018Publication date: September 9, 2021Applicant: SUZHOU UNIVERSITY OF SCIENCE AND TECHNOLOGYInventors: Zhigang CHEN, Feng CHEN, Junchao QIAN, Chengbao LIU, Chencheng WANG
-
Patent number: 10429567Abstract: A multi-view pixel directional backlight module and a naked-eye 3D display device are provided. The multi-view pixel directional backlight module includes at least two rectangular light guide plates closely stacked together. A light-emerging surface of the rectangular light guide plate is provided with multiple pixel arrays. Light emitted by pixels in a same pixel array is pointed to a same viewing angle, and different pixel arrays have different viewing angles. At least one side of each rectangular light guide plate is provided with a light source group. Light emitted by the light source group enters the corresponding light guide plate, then emerges from pixels of respective pixel arrays on the light-emerging surface of the light guide plate, and is totally reflected at positions other than positions of the pixels within the light guide plate. Each of the pixels is a nano-diffraction grating.Type: GrantFiled: March 30, 2015Date of Patent: October 1, 2019Assignees: SUZHOU UNIVERSITY, SUZHOU SVG OPTRONICS TECHNOLOGY CO., LTDInventors: Wenqiang Wan, Linsen Chen, Yimin Lou, Donglin Pu, Ming Zhu, Pengfei Zhu, Su Shen, Yan Ye
-
Patent number: 8961166Abstract: An apparatus for manufacturing a light guide film may comprise a feed roller, a receiving roller, a separating device, a hot press printing device and a recombining device. Firstly, the separating device may separate a protective layer from a substrate layer of the light guide film. Secondly, a surface of the substrate layer to be manufactured may be impressed with light guide dots by the hot press printing device, and the recombining device recombine the peeled protective layer to the substrate layer. And lastly, the finished light guide film is recycled by the receiving roller. The apparatus may have advantages such as high output and low cost, and it may manufacture a large dimensioned product.Type: GrantFiled: December 13, 2010Date of Patent: February 24, 2015Assignees: SVG Optronics Co., Ltd., Suzhou UniversityInventors: Zhihua Wu, Xiachong Zhou, Zongbao Fang, Su Shen, Guojun Wei, Donglin Pu, Linsen Chen