Abstract: The invention concerns a pharmaceutical composition for treating and/or preventing cancer comprising at least an anti-cancer agent, characterised in that said anticancer agent is associated in the composition with at least a peptide capable of carrying said agent into the cancer cells and prevent the occurrence of chemoresistance to said agent.

Abstract: The invention concerns the use of a linear peptide paired with an active substance for diagnosing or treating a CNS pathology by preparing a medicine capable of crossing the blood brain barrier to be used for diagnosis or treatment of a pathology localized in the CNS.

Abstract: The invention relates to conjugates of an antigen coupled to a linear derivative of a ?-stranded antibiotic peptide, which are useful for immunogenic agents to enhance a CTL response. Two groups of preferred peptides are derived from the antibiotics protegrin and tachyplesin.

Abstract: A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and an acceptable vehicle.

Abstract: The present invention is concerned with a computer-aided method for the provision, identification and description of molecules exhibiting a desired behaviour, more particularly in the pharmaceutical sector, employing a molecular modelling step, a combinatorial library building step and a step of selecting potentially useful molecules, said method including a step whereby the candidate molecules are filtered using a dynamic filter representing constraints of conformational variations which the molecules must satisfy in order to exhibit said activity.

Abstract: A pharmaceutical composition including at least one therapeutic molecule effective for treating lung cancers or pulmonary diseases; and at least one peptide vector that augments bioavailability of the molecule in a patient's lungs selected from the group consisting of Ala-Trp-Ser-Phe-Arg-Val-Ser-Tyr-Arg-Gly-Ile-Ser-Tyr-Arg-Arg-Ser-Arg (SynB4) (SEQ ID No. 1), and Arg-GLy-Gly-Arg-Leu-Ser-Tyr-Ser-Cit-Cit-Cit-Phe-Ser-Thr-Ser-Thr-Gly-Arg (SynB6) (SEQ ID No. 2).

Abstract: Peptides containing or composed of an antibiotic peptide derivative by (i) modifying the cysteine residues such that the peptide is free of disulphide bridges, (ii) substituting 1 to 18 and, preferentially, 1 to 6 amino acids and/or permuting at least one amino acid pair, the substitutions and/or permutation being such that the peptide is amphipathic in nature, and a compound formed from at least one of the peptides bound directly or indirectly to at least one active substance.