Patents Assigned to SYNT:EM
  • Peptides carrying substances across the blood brain barrier
    Patent number: 7399747
    Abstract: The invention concerns the use of a linear peptide paired with an active substance for diagnosing or treating a CNS pathology by preparing a medicine capable of crossing the blood brain barrier to be used for diagnosis or treatment of a pathology localized in the CNS.
    Type: Grant
    Filed: November 26, 1999
    Date of Patent: July 15, 2008
    Assignee: SYNT:EM
    Inventors: Philippe Clair, Michel Kaczorek, Jamal Temsamani
  • Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation
    Publication number: 20070161553
    Abstract: A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and an acceptable vehicle.
    Type: Application
    Filed: February 2, 2005
    Publication date: July 12, 2007
    Applicant: SYNT:EM
    Inventors: Daniele Mathieu, Jamal Temsamani, Michel Kaczorek