Patents Assigned to SYNT:EM
  • Patent number: 7399747
    Abstract: The invention concerns the use of a linear peptide paired with an active substance for diagnosing or treating a CNS pathology by preparing a medicine capable of crossing the blood brain barrier to be used for diagnosis or treatment of a pathology localized in the CNS.
    Type: Grant
    Filed: November 26, 1999
    Date of Patent: July 15, 2008
    Assignee: SYNT:EM
    Inventors: Philippe Clair, Michel Kaczorek, Jamal Temsamani
  • Patent number: 7314626
    Abstract: The invention relates to conjugates of an antigen coupled to a linear derivative of a ?-stranded antibiotic peptide, which are useful for immunogenic agents to enhance a CTL response. Two groups of preferred peptides are derived from the antibiotics protegrin and tachyplesin.
    Type: Grant
    Filed: October 15, 2002
    Date of Patent: January 1, 2008
    Assignee: SYNT:EM S.A.
    Inventors: Mark Elliott Johnson, Fiona Hamilton Day, Michel Kaczorek, Jamal Temsamani
  • Publication number: 20070161553
    Abstract: A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and an acceptable vehicle.
    Type: Application
    Filed: February 2, 2005
    Publication date: July 12, 2007
    Applicant: SYNT:EM
    Inventors: Daniele Mathieu, Jamal Temsamani, Michel Kaczorek
  • Patent number: 7024311
    Abstract: The present invention is concerned with a computer-aided method for the provision, identification and description of molecules exhibiting a desired behaviour, more particularly in the pharmaceutical sector, employing a molecular modelling step, a combinatorial library building step and a step of selecting potentially useful molecules, said method including a step whereby the candidate molecules are filtered using a dynamic filter representing constraints of conformational variations which the molecules must satisfy in order to exhibit said activity.
    Type: Grant
    Filed: July 22, 1999
    Date of Patent: April 4, 2006
    Assignee: Synt:EM S.A.
    Inventors: Gérard Grassy, Michel Kaczorek, Roger Lahana, Abdelaziz Yasri
  • Publication number: 20050159360
    Abstract: A pharmaceutical composition including at least one therapeutic molecule effective for treating lung cancers or pulmonary diseases; and at least one peptide vector that augments bioavailability of the molecule in a patient's lungs selected from the group consisting of Ala-Trp-Ser-Phe-Arg-Val-Ser-Tyr-Arg-Gly-Ile-Ser-Tyr-Arg-Arg-Ser-Arg (SynB4) (SEQ ID No. 1), and Arg-GLy-Gly-Arg-Leu-Ser-Tyr-Ser-Cit-Cit-Cit-Phe-Ser-Thr-Ser-Thr-Gly-Arg (SynB6) (SEQ ID No. 2).
    Type: Application
    Filed: December 17, 2004
    Publication date: July 21, 2005
    Applicant: SYNT:EM, a corporation of France
    Inventors: Jamal Temsamani, Anthony Rees, Christophe Rousselle
  • Publication number: 20030186890
    Abstract: Peptides containing or composed of an antibiotic peptide derivative by (i) modifying the cysteine residues such that the peptide is free of disulphide bridges, (ii) substituting 1 to 18 and, preferentially, 1 to 6 amino acids and/or permuting at least one amino acid pair, the substitutions and/or permutation being such that the peptide is amphipathic in nature, and a compound formed from at least one of the peptides bound directly or indirectly to at least one active substance.
    Type: Application
    Filed: January 3, 2003
    Publication date: October 2, 2003
    Applicant: SYNT:EM S.A.
    Inventors: Guillaume Drin, Jerome Gomar, Jamal Temsamani, Anthony R. Rees