Abstract: The invention provides isolated DNA molecules encoding the human, mouse and rat NPY-Y5 receptors. These isolated DNA molecules can be used to express the NPY-Y5 receptors in cells which can then be used to screen compounds for NPY agonist and antagonist activity.

Abstract: Isolated DNA molecules are disclosed corresponding to a novel progestin-regulated gene (PRG1). The PRG1 polypeptide (PRG1) and uses thereof are also described, and include assays for assessing progestin-responsiveness in a subject.

Abstract: The present invention provides the nucleotide and amino acid sequence of a previously unidentified erbB receptor target.

Abstract: A method of assessing an individual's predisposition to bipolar affective disorder comprises determining the presence of one or more bipolar affective disorder-linked markers on chromosome 4 or analyzing allelic variation in relation to a bipolar affective disorder susceptibility gene on chromosome 4.

Abstract: An expression vector for use in producing transgenic animals and cell lines, the expression vector comprising a portion of the 5' flanking sequence of the human osteocalcin gene and a portion of the 3' flanking sequence of the human osteocalcin gene, the flanking sequences being separated by a linker encoding at least one unique restriction site. Reporter genes introduced into the linker can be expressed in a bone cell-specific manner in animals for screening therapeutic compounds suspected to affect osteoblasts and/or bone physiology.

Abstract: The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.

Abstract: The present invention consists in a method of preparing amino thiohydantoins either in isolation or as the C-terminals residue of a peptide. The method comprises reacting the amino acid or peptide with an acylating agent and thiocyanate or isothiocyanates in the presence of a strong acid. The present invention also relates to an improved method for C-terminal sequencing of peptides which routinely analyses all of the common amino acids of peptides. The invention involves the use of a strong, volatile, anhydrous organic or mineral acid to cleave the terminal amino acid thiohydantoin.

Abstract: The present invention provides peptides and compounds which inhibit the enzyme activity of Type II phospholipases A.sub.2. The preferred compounds are pentapeptides. Where the phospholipase is human Type II phospholipase A.sub.2 the preferred peptides are FLSYK and KFLSY.

Abstract: The present invention relates to protein kinase C (iota). The present invention provides this protein in a substantially pure form and also provides nucleotide sequences encoding the protein. The invention further relates to methods of screening for compounds having human protein kinase C (iota) agonist or antagonist activity.

Abstract: The present invention provides a genetic test for assaying predisposition to and/or resistance to high rates of bone turnover, development of low bone mass and responsiveness or otherwise to therapeutic modalities. This is a specific model for use in prediction of osteoporosis and likely response to preventive or therapeutic modalities. It is a general model of allelic variation in transcriptional regulators determining physiological set-points and thus susceptibility or resistance to certain pathophysiological states.

Abstract: The invention provides cDNA sequence and a genomic DNA sequence which encodes the human neuropeptide Y-Y1 receptor. These DNA sequences can be used to express the NPY-Y1 receptor in cells and can be sued to screen compounds for neuropeptide Y agonist and antagonist activity.