Patents Assigned to THE LONDON HEALTH SCIENCES CENTRE RESEARCH INC.
  • Patent number: 8151593
    Abstract: Various embodiments for an apparatus and method for preparing frozen tissue specimens are described. In an exemplary embodiment, the apparatus includes a sample container for receiving an excised tissue sample and embedding material. The sample container includes a flat base along which the tissue sample is flattened. The apparatus further includes a freezing box with a freezing platform and a freezing agent. The sample container is placed on the freezing platform to begin the freezing process. A chuck with a generally planar surface can be placed on the sample container during the freezing process joining the chuck, tissue specimen, and sample container base in generally parallel planes. In some cases, the sample container can be made from a suitable material, such as plastic, that is at least semi-transparent to allow visual confirmation of tissue flatness and freezing.
    Type: Grant
    Filed: September 7, 2006
    Date of Patent: April 10, 2012
    Assignee: London Health Sciences Centre Research Inc.
    Inventors: Colin Henderson, Claire Temple-Oberle
  • Publication number: 20120032882
    Abstract: The present invention describes a hands-free system for controlling the movement of a cursor on one or more display devices. A tracking device including a traceable marker and one or more accelerometers and gyroscopes are used to track position and acceleration of the marker relative to a target of interest. A processing means processes the motion signals from the tracking device to determine the location of the cursor on the operator's monitor, which may also be displayed on more monitors. The tracking device is worn by the operator, optimally on the operator's head. The operator's head movements determine movement of the cursor.
    Type: Application
    Filed: November 20, 2009
    Publication date: February 9, 2012
    Applicant: London Health Sciences Centre Research Inc.
    Inventors: Christopher M. Schlachta, Rajnikant V. Patel, Ana Luisa Trejos, Michael David Naish
  • Publication number: 20120014920
    Abstract: There is provided a composition comprising an effective amount of Annexin A5 for use in treatment of an inflammatory disorder. There is provided a composition comprising an effective amount of Annexin A5 for use in improving organ function. Methods for administering such compositions for treatment of animals are also provided.
    Type: Application
    Filed: October 16, 2009
    Publication date: January 19, 2012
    Applicant: LONDON HEALTH SCIENCES CENTRE RESEARCH INC.
    Inventors: Qingping Feng, Xiangru Lu, Paul Arnold
  • Publication number: 20110152633
    Abstract: A method for predicting health compromise in a fetus comprises acquiring one or more EEG signals and a fetal heart rate (FHR) signal from the surface of the head of a fetus; and determining the spectral edge frequency (SEF) of the one or more EEG signals. A repetitive temporal correlation between the FHR signal and the SEF of the one or more EEG signals is indicative of fetal health compromise. A system for detecting the correlation between FHR signal and the SEF of the one or more EEG signals and predicting fetal health compromise is also described.
    Type: Application
    Filed: March 28, 2008
    Publication date: June 23, 2011
    Applicant: THE LONDON HEALTH SCIENCES CENTRE RESEARCH INC.
    Inventors: Bryan S. Richardson, Martin G. Frasch
  • Patent number: 7902421
    Abstract: The invention is an animal model which exhibits neuropathological and behavioral features associated with human schizophrenia. The invention also encompasses an in vivo method of preparing an animal model of human schizophrenia. Such a model is useful for screening and identifying therapeutic agents for treating human schizophrenia.
    Type: Grant
    Filed: March 1, 2004
    Date of Patent: March 8, 2011
    Assignee: London Health Sciences Centre Research Inc.
    Inventors: Nagalingam Rajakumar, Bavani Rajakumar
  • Publication number: 20100290989
    Abstract: Compositions comprising hyaluronic acid (HA) or agents that interfere with HA binding of HA receptors and methods of using the same are provided. For example, there is provided a composition comprising HA oligomers ranging in size from 10-mer to 80-mer and use of the same for promoting migration, growth or survival of wild-type or transformed/cancerous cells. There is also provided a composition comprising an agent that interferes with binding between an HA oligomer of a size of about 10-mer to about 80-mer and an HA receptor. Such compositions may be useful for therapeutic, diagnostic or imaging applications. Examples of therapeutic use are wound repair or cancer treatment.
    Type: Application
    Filed: October 10, 2008
    Publication date: November 18, 2010
    Applicants: LONDON HEALTH SCIENCES CENTRE RESEARCH INC., REGENTS OF THE UNIVERSITY OF MINNESOTA
    Inventors: Cornelia Tolg, Eva Turley, Jim McCarthy, Leonard G. Luyt
  • Patent number: 7732564
    Abstract: The present invention relates to a rodent serum marker for prostate cancer comprising b-microseminoprotein (PSP94) and diagnostic methods thereof. The present invention also relates to a recombinant sequence to raise a ligand of a specific binding affinity to a rodent serum marker for prostate cancer, which comprises the following amino acid sequence: (SEQ ID NO: 1) MGGSHHHHHHGMASMTGGGGMGRNTRYDDDDKDRWGSWVCSIENREIFPN QMSDDCMDADGNKHFLNTPKKNCTWCSCDKTSITCCTNATPLSYDKDNCD VQFHPENCTYSVVDRKNPGKTCRVDSWTM.
    Type: Grant
    Filed: April 28, 2006
    Date of Patent: June 8, 2010
    Assignee: London Health Sciences Centre Research Inc.
    Inventors: Jim W. Xuan, Joseph L. Chin
  • Publication number: 20100028350
    Abstract: The present invention provides new methods for treating, minimizing and/or preventing inflammatory injury involving IL-2 activity on epithelial cells expressing IL-2 receptors. Methods for reducing or preventing inflammatory injury in a tissue/organ comprise inhibiting IL-2 receptor activity in cells of the tissue/organ.
    Type: Application
    Filed: March 5, 2007
    Publication date: February 4, 2010
    Applicant: London Health Sciences Centre Research Inc.
    Inventors: Anthony M. Jevnikar, Caigan Du
  • Publication number: 20090220582
    Abstract: The present invention is a method for the treatment of cancer involving tumor derived immunosuppression in a subject. The method comprises administering to a subject one or more siRNA constructs capable of inhibiting the expression of an immunosuppressive molecule. The invention also provides siRNA constructs and compositions.
    Type: Application
    Filed: June 15, 2006
    Publication date: September 3, 2009
    Applicant: LONDON HEALTH SCIENCES CENTRE RESEARCH INC.
    Inventor: Weiping Min
  • Publication number: 20080311552
    Abstract: The invention is the modification of organs, tissues and cells with a storage/reperfusion solution comprising siRNAs specific for genes whose expression is associated with loss of viability or cell damage. The presence of siRNAs in the storage/reperfusion solution minimizes and/or prevents organ, tissue and cell damage such that the organs, tissues or cells can be used for in vivo transplantation. The invention is also directed generally to methods for maintaining organs, tissues and cells in a viable state using the storage/reperfusion solution.
    Type: Application
    Filed: September 20, 2006
    Publication date: December 18, 2008
    Applicant: London Health Sciences Centre Research, Inc.
    Inventor: Weiping Min
  • Patent number: 7361331
    Abstract: A plant expressing a cytokine and an autoantigen is disclosed. An example of a cytokine is a contra-inflammatory cytokine, for example IL-4 and IL-10, and an example of autoantigen is GAD. A novel method for the production of transgenic proteins of interest suitable for oral administration is also disclosed. Further, non-food crop plants expressing one or more proteins of interest are disclosed, as is a method involving the preparation of a protein of interest suitable for oral administration within a non-food crop plant comprising, transforming the non-food crop plant with a suitable vector containing a gene of interest and appropriate regulatory regions to ensure expression of the gene of interest within the non-food crop plant, such that the non-food crop plant is characterized as being non-toxic, non-addictive, palatable, and requiring minimal or no processing prior to oral administration. An example of a non-food crop plant is low alkaloid tobacco.
    Type: Grant
    Filed: May 3, 2002
    Date of Patent: April 22, 2008
    Assignees: Her Majesty The Queen in Right of Canada, as represented by the Minister of Agriculture and Agri-Food, London Health Sciences Centre Research Inc.
    Inventors: Jim Brandle, Shengwu Ma, Rima Menassa, Anthony Jevnikar, Terry Delovitch
  • Publication number: 20060246521
    Abstract: The present invention relates to a rodent serum marker for prostate cancer comprising b-microseminoprotein (PSP94) and diagnostic methods thereof. The present invention also relates to a recombinant sequence to raise a ligand of a specific binding affinity to a rodent serum marker for prostate cancer, which comprises the following amino acid sequence: (SEQ ID NO:1) MGGSHHHHHHGMASMTGGGGMGRNTRYDDDDKDRWGSWVCSIENREIFPN QMSDDCMDADGNKHFLNTPKKNCTWCSCDKTSITCCTNATPLSYDKDNCD VQFHPENCTYSVVDRKNPGKTCRVDSWTM.
    Type: Application
    Filed: April 28, 2006
    Publication date: November 2, 2006
    Applicant: LONDON HEALTH SCIENCES CENTRE RESEARCH INC.
    Inventors: Jim Xuan, Joseph Chin
  • Publication number: 20060127953
    Abstract: Methods for detecting osteolysis are described. The diagnostic method involves detecting the presence of regulatory T cells in a sample from a patient.
    Type: Application
    Filed: September 18, 2003
    Publication date: June 15, 2006
    Applicant: London Health Sciences Centre Research Inc.
    Inventors: Sean Frost, Steven McDonald, Kelly Summers
  • Patent number: 7010356
    Abstract: The invention provides a multichannel electrode (“MC electrode”) which can perform multiple functions such as recording, stimulating and lesioning simultaneously or sequentially upon a single insertion into a target site. In one aspect, the MC electrode further provides imaging and drug delivery capabilities. The invention also provides interface connectors for connecting the MC electrode to external units such as data acquisition and/or stimulation systems. Although the MC electrode and associated connectors and system(s) provide an optimal way to perform deep brain surgical procedures, the MC electrode and associated connectors and system(s) are useful generally in any technique which relies on recording, activating, and/or inhibiting electrical signals produced by cells.
    Type: Grant
    Filed: October 31, 2001
    Date of Patent: March 7, 2006
    Assignee: London Health Sciences Centre Research Inc.
    Inventors: Mandar Jog, Suwas Nikumb