Abstract: The subject of the present invention is a peptide, natural or synthetic, which comprises an amino acid sequence that has at least 80% sequence identity with the sequence SDRSLHLEANEKGENVNVHVTKTRADKSKIKVSVRQYADINEKGEAQYKCP-VAQLE (SEQ ID NO: 1). A further object of the present invention is said peptide which has at least 80% sequence identity with the sequence SEQ ID NO: 1 which is a JNK3 inhibitor for use in the prevention and / or treatment of neurodegenerative or neurodevel-opmental diseases.

Abstract: A device and a process used to purify air from pollutants are disclosed. The device has at least one empty body defining a chamber intended to receive an air flow to be purified and having at least one inlet hole for the air, and at least one outlet hole for the air. The chamber has an electric field generator, at least one photocatalyst, intended to be excited by a luminous radiation, implementing a photocatalysis process, at least one luminous radiation source intended to excite the photocatalyst, and at least one adsorbing material. The electric field generator, the at least one photocatalyst and the at least one adsorbing material are disposed in the chamber in such manner to cooperate.

Abstract: An object of the present invention is the use of Irisin for the treatment and/or prevention of osteoporosis. In particular, the present invention refers to the use of recombinant irisin for the treatment and/or prevention of osteoporosis. A method for preventing and/or treating osteoporosis by administering an effective amount of irisin to a subject, is provided.

Abstract: The present description refers to eco-compatible compositions for sunscreening the body, in particular to sunscreens for the protection of human health, compatible with organism life and not harmful to marine ecosystems (in particular for tropical environments with coral reefs).

Abstract: A method for measuring the refractive index of a material with Bragg gratings includes the emission of a collimated radiation beam (9) from a radiation source (4) with a large spectrum and orientation thereof along a direction normal to the material (2) to be examined, the propagation of the collimated radiation beam (9) entering the material (2), then a Bragg diffraction grating (3) that is obliquely placed to the direction of the collimated radiation beam (9), and again the material (2), the subjection to spectral analysis of the collimated radiation beam exiting the material (2), the grating (3) producing a minimum in the spectrum subjected to the spectral analysis in accordance with Bragg's law, and the calculation of the refractive index of the material (2) from the measure of the wavelength corresponding to the minimum in thus spectrum. A relevant apparatus is described.