Abstract: A composition for the adhesion of biological tissues to one another, for the adhesion of a material to a biological tissue, for the adhesion of an adhesive or of a substance to the surface of a biological tissue, for blocking an orifice in a biological tissue, for reinforcing a biological tissue and/or for fixing and stabilising a biological tissue. A monomer that is polymerisable under the effect of ultraviolet (UV) radiation and in that the viscosity of said composition is less than 10 mPa·s at 20° C.

Abstract: A device for generating a pivot drug database implemented in a computer system, the device includes an extraction unit configured for extracting the data from a set of elementary drug data sources, the elementary drug data sources storing drug-related data, each elementary data source being associated with a representation of the data; a structuring unit configured for structuring the extracted data by applying a pivot ontology to the extracted data, the pivot ontology defining classes derived from one or more ontologies of the drug and relationships between the classes, which provides structured data associated with a graph representing the relationships between the classes corresponding to the structured data; the device being configured for generating the pivot drug database according to the graph and the structured data, the pivot database storing the structured data. Applications: drug interaction analysis tools, tool for assisting medical prescription.

Abstract: Disclosed are new precursors of recyclable cross-linked diene elastomers including chain-end units with furanyl groups, their use in the preparation of the recyclable elastomers and their process of preparation. Also disclosed are new recyclable cross-linked diene elastomers, their preparation process and their uses.

Abstract: The present invention concerns a block copolymer having at least one oligo- or polysaccharide block and at least one elastin-like polypeptide block, wherein said block copolymer comprises at least one repetitive unit having the following formula (I): wherein R? is the side chain of a natural or synthetic amino acid other than proline and derivatives thereof.

Abstract: The invention relates to a composition comprising a blend of fluorinated electroactive polymers and having a dielectric permittivity that exhibits greater stability over the operating temperature range with respect to each polymer employed on its own. The invention also relates to formulations and films produced on the basis of said composition. The invention also relates to a field-effect transistor, at least part of the dielectric layer of which is composed of a blend of fluorinated electroactive polymers.

Abstract: A microfluidic chip comprising at least one dialysis crystallisation cell. The cell includes: a substrate made of PMMA; a first level including a tank defined at least partially by the substrate and by an outer wall of the cell, the tank being in fluid communication with a channel for inlet and a channel for outlet of a solution allowing the crystallisation method to be implemented; and a second level including a dialysis chamber defined at least partially by an inner wall of the cell without contact with the substrate and by a dialysis membrane forming an interface between the tank and the dialysis chamber, the inner wall including at least one one-piece portion in which the periphery of the membrane is kept sealed.

Abstract: Disclosed is a hybrid inertial measurement system including a cold atom interferometric inertial sensor having a laser source generating a sequence of laser pulses towards a cold atom burst and a conventional inertial sensor attached to the inertial reference frame of the interferometric inertial sensor. The hybrid system includes a signal processing system suitable for receiving an inertial measurement signal from the conventional inertial sensor and for generating in real time a non-linear frequency modulation signal, the feedback loop electronic system being configured to modulate in real time the central optical frequency of the laser according to the modulation signal, such that the cold atom interferometric inertial sensor generates a first hybrid inertial measurement signal by atomic interferometry corrected for the relative movements of the inertial reference frame.

Abstract: A medical device includes a catheter, which includes a first lumen for injection of a first volume of a treatment solution, the first lumen opening out at the distal end of the catheter; and a junction element extending the first lumen at the end of the catheter including a diameter at the distal end thereof less than the diameter of the catheter.

Abstract: A device is disclosed for determining characteristic parameters of the dimensions of nanoparticles in suspension in a liquid. The device emits an incident light beam that is linearly polarized along a polarization axis; a detecting unit comprising a measurement arm that is rotatable with respect to an axis of rotation, the detecting unit comprising first and second detection channels that are separated by a polarization-splitting element arranged in the measurement arm; a fixed sample holder receives a container of cylindrical symmetry of the sample, an axis of symmetry of the container being coincident with the axis of rotation of the measurement arm; and a control unit. The polarization-splitting element of the measurement arm is configured to simultaneously send, over each of the first and second detection channels, respectively, a first and second polarized component of the beam scattered by the sample.

Abstract: A process including introducing, into a device, an aqueous fluid containing at least one inorganic salt, the water of the aqueous fluid being in supercritical conditions or close to the supercritical range in the device, and measuring the concentration or the amount of inorganic salt in the device, this measurement preferably being carried out before the entry of the inorganic salt into the device, Then bringing the inorganic salt into contact with an aqueous flow containing at least one hydroxide salt to obtain in the device an aqueous fluid mixture containing an inorganic salt and a hydroxide salt and adjusting the concentration or amount of the hydroxide salt as a function of the concentration or amount of the inorganic salt needed to at least partially solubilize the inorganic salt. Preferably the measurement of the concentration or the amount of inorganic salt leaving the device is also performed.

Abstract: A subtractive method for structuring a hydrogel, comprising the following steps: producing a hydrogel layer containing benzophenone (3) on a substrate (6), the hydrogel not having any photocleavable group; bringing the hydrogel layer into contact with an oxygen tank (4); selectively illuminating the hydrogel layer with a light (5) capable of activating the benzophenone in order to convert the illuminated zone of the hydrogel layer into a liquid; and eliminating the liquid.

Abstract: The present disclosure provides a portable device and method for controlling an alcoholic beverage through an at least partially transparent container. The method includes acquiring a fluorescence spectrum of the beverage through a wall of the container, normalizing a profile of a measured spectrum according to the maximum intensity of a reference spectrum, calculating a resemblance factor between the measured spectrum and the reference spectrum, and determining if the beverage is genuine according to the obtained value of the resemblance factor.

Abstract: A specific binding molecule is provided which binds to galectin-3 protein, methods of their production and methods of use.

Abstract: The invention relates to a method for determining active concentrations of an analyte and optionally kinetic constants for the interaction of the analyte with a ligand in complex biological samples by means of surface plasmon resonance comprising the use of an auto-blank.

Abstract: A method for printing uses at least one bio-ink. The method also uses at least one laser print head to deposit at least one droplet of at least one bio-ink onto a depositing surface of a receiving substrate. The printing method uses at least one nozzle print head to deposit at least one droplet of at least one bio-ink onto a depositing surface of the same receiving substrate as the laser print head.

Abstract: An elementary antenna includes a planar radiating device comprising a substantially flat radiating element having a center and a plane defined by (i) a straight line passing through the center and (ii) another straight line perpendicular to the straight line and passing through the center, the radiating element comprising pairs of excitation points arranged in a quadruplet of excitation points located at a distance from the lines, comprising a first pair of excitation points arranged substantially symmetrically in relation to the straight line and a second pair of excitation points arranged substantially symmetrically in relation to the other line, the elementary antenna comprising processing to supply differential excitation signals for (i) exciting the excitation points and/or (ii) shaping signals emitted from the excitation points.

Abstract: The present invention relates to methods for predicting acute severe colitis treatment response. Currently, there is no biomarker of drug response. The present invention provides the first prediction tool for responses to first- and second-line treatments in acute severe ulcerative colitis. Putative mRNA targets of dysregulated microRNAs were identified from patient biopsies. One classifier of fifteen colonic microRNAs plus five biological values at admission were identified with a prediction accuracy of 96.6% for discriminating responders from non-responders to steroids. Using a similar method, 6 and 4 mucosal microRNA-based algorithms were identified to classify responders from non-responders to infliximab and cyclosporine.

Abstract: Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.

Abstract: A method for printing uses at least one bio-ink. The method also uses at least one laser print head to deposit at least one droplet of at least one bio-ink onto a depositing surface of a receiving substrate. The printing method uses at least one nozzle print head to deposit at least one droplet of at least one bio-ink onto a depositing surface of the same receiving substrate as the laser print head.

Abstract: Methods to correct for biases and inaccuracies of subjective data sources are provided. In some instances, data sources provide an indication of quality of an item, and various methods determine an instrinsic quality of the item from the data. In some instances, various methods utilize ratings provided by a collection of raters to determine an intrinsic quality. Biases and inaccuracies of raters can be determined and can be utilized for correction in order to reach an intrinsic quality of an item. A number of applications utilizing quality of an item quality and biases and inaccuracies of raters are also described.