Panasonic Patents

Panasonic Corporation manufactures and sells electronic and electric products. Its products include audiovisual equipment (such as flat-panel televisions, Blu-ray recorders, digital cameras, PCs projectors and in-flight entertainment systems), home appliances (such as cooking, beauty, cooling and heating equipment), systems and communications products (such as mobile phones and surveillance and security cameras). Panasonic also offers lighting, automotive systems (such as car navigation systems) and industrial devices (such as electronic components, electronic materials, semiconductors and optical devices).

Panasonic Patents by Type

  • Patent number: 9894855
    Abstract: To grow a plant which stores nutrients synthesized in an above-ground part into an underground part, a hydroponic cultivation apparatus waters the underground part. The hydroponic cultivation apparatus includes: a void portion housing the underground part while establishing a substantially sealed state; a sensor which detects an amount of moisture in the void portion at the underground part or around the underground part; an air conditioning fan which introduces outside air to the void portion and controls temperature and humidity inside the void portion; and a controller which controls the amount of moisture detected by the sensor by driving the air conditioning fan in such a way as to adjust an amount of the outside air or an introduction period of the outside air.
    Type: Grant
    Filed: March 3, 2014
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Hiroshi Yano, Ayumi Sakai, Sayaka Kato
  • Patent number: 9900645
    Abstract: Methods and systems for a transportation vehicle are provided. One method includes interfacing a PED with an IFE system that includes a function associated with an object; capturing an image of an object by the PED, identifying the function associated with the object using the captured image and an application of the PED; presenting an option by the application to activate the function; and upon selection of the option by a user, communicating a request to IFE system to activate the function.
    Type: Grant
    Filed: November 18, 2016
    Date of Patent: February 20, 2018
    Assignee: Panasonic Avionics Corporation
    Inventors: Chin Perng, Geethanjali Balasubramanian, Gurmukh Khabrani, Raymond Hackley Vincent, Jr.
  • Patent number: 9900650
    Abstract: Video recognition processing on video signals input from an outside is performed. Hence, video reception device which is configured to transmit and receive data through communication network includes input unit, video extraction unit, video recognition region setting unit, control unit and additional information display control unit. The video recognition region setting unit sets a video recognition region to a partial video based on feature information indicating features of video signals input from an outside. The additional information display control unit generates content recognition information in the video recognition region of the partial video. The control unit performs control of requesting video recognition device to perform video recognition processing on this content recognition information.
    Type: Grant
    Filed: July 3, 2014
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Hiroshi Yabu, Hirotaka Oku
  • Patent number: 9900821
    Abstract: When a handover request for performing a handover of a terminal (70) from a macro cell C1 to a CSG cell C2 is received from an SeNB 10 (S8), a base station (TeNB) (40) of the CSG cell C2 transmits a handover response in accordance with a handover enabled/disabled state (S12). The handover response includes an identifier of the terminal (70) in the CSG cell C2. Upon receiving the response, the SeNB (10) notifies the identifier to the terminal (70) (S14). The TeNB (40) repeatedly transmits a dedicated signal containing a handover command via a dedicated channel set using the identifier at an interval shorter than a gap period (S18). Accordingly, whether or not access is permitted can be judged promptly and a smooth handover can be realized.
    Type: Grant
    Filed: June 23, 2017
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Corporation of America
    Inventors: Hidenori Matsuo, Takahisa Aoyama, Hong Tat Toh, Hidetoshi Suzuki
  • Patent number: 9900616
    Abstract: A moving picture coding apparatus includes a counter unit which counts the number of pictures following an intra coded picture; and a motion estimation unit which compares respectively only reference pictures which are the intra coded picture or the following pictures, selected from among a reference picture Ref1, a reference picture Ref2 and a reference picture Ref3 stored in memories, with a picture signal, and determines the reference picture whose inter picture differential value is smallest.
    Type: Grant
    Filed: October 14, 2015
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY CORPORATION OF AMERICA
    Inventors: Shinya Kadono, Satoshi Kondo, Makoto Hagai
  • Patent number: 9896211
    Abstract: The control device individually controls operations of the two or more lighting devices. Each lighting device includes a light source, a sensor for measuring light intensity of the light source, and a controller circuit for controlling the light source. The control device includes a replacement detector circuit, and the replacement detector circuit determines whether any of the lighting devices has been replaced, and obtains a determination result distinguishing a replacement lighting device from remaining lighting device(s).
    Type: Grant
    Filed: March 6, 2017
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Nobuyuki Matsui, Youji Tachino
  • Patent number: 9896500
    Abstract: The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.
    Type: Grant
    Filed: December 22, 2016
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventors: Keiko Yugawa, Jin Muraoka, Junko Muraoka, Hiroshi Nakayama
  • Patent number: 9895210
    Abstract: An electric linear actuator includes a fixed block, an output movable block, a counter movable block, a projecting side coupling member, a retracting side coupling member, a block coupling member, and an output functional member. The output movable block and the counter movable block are configured to be reciprocated in the movable direction in opposite phases by electromagnetic force acting between the fixed block and the output and counter movable blocks. The projecting side coupling member is coupled to the output movable block and the counter movable block. The retracting side coupling member is coupled to the output movable block and the counter movable block. The projecting side coupling member and the retracting side coupling member have different shapes.
    Type: Grant
    Filed: December 12, 2013
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventors: Noboru Kobayashi, Masashi Moriguchi
  • Patent number: 9895988
    Abstract: In the present invention, an electricity supply unit (103) contactlessly supplies electricity using electromagnetic induction to an electricity reception unit (153) provided to a vehicle. An electricity supply coil (103a) has a ring shape, and supplies electricity to the electricity reception unit (153) while facing the electricity reception unit (153). A casing (103b) houses the electricity supply coil (103a). The casing (103b) has an inclined section (202) that is inclined in a manner so as to approach the electricity supply coil (103a) gradually in the direction towards the outer periphery (212) of the electricity supply coil (103a) in the radial direction of the electricity supply coil (103a) at the portion at which the electricity supply coil (103a) is projected when the electricity supply coil (103a) is projected at the casing (103b) in the direction towards the electricity reception unit (153).
    Type: Grant
    Filed: March 13, 2013
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Masayoshi Koizumi, Osamu Ohashi, Tsuyoshi Nishio, Noriaki Asaoka
  • Patent number: 9896210
    Abstract: The display unit of the present disclosure has a main unit, a display disposed on the main unit so as to be movable between a first position and a second position, a motor for driving the display, a driving state detector for detecting the driving state of the motor, a current detector for detecting motor current, and a controller for controlling the driving state of the motor. When the current detector detects a predetermined current value suitable for the driving state detected by the driving state detector, the controller provides the motor with a predetermined drive control.
    Type: Grant
    Filed: January 7, 2016
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Yuki Noda, Keijiroh Nagano
  • Patent number: 9895874
    Abstract: A screen printing apparatus for printing paste on a printed pattern of a print target constituted of a substrate or a plurality of aligned substrates includes a mask having a plurality of opening patterns different in size from one another. The screen printing apparatus images the substrate or one of the aligned substrates constituting the print target, and calculates a level of deformation by expansion and contraction of the print target, based on a result of the imaging. The screen printing apparatus then selects an opening pattern from among the opening patterns, based on the calculated level of deformation by expansion and contraction of the print target, brings the print target into contact with the mask to superimpose the selected opening pattern on the printed pattern, and deposits the paste on the printed pattern.
    Type: Grant
    Filed: April 13, 2017
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventor: Masayuki Mantani
  • Patent number: 9897286
    Abstract: A phosphor optical element includes: a base member; a phosphor-containing member that includes a transparent member containing a phosphor particle; and a cover member, wherein the base member, the phosphor-containing member, and the cover member are sequentially formed on a transparent base that is transparent to a wavelength of incident light from an excitation light source, the phosphor particle has a diameter no greater than the wavelength of the incident light, and in an arbitrary cross section of the phosphor-containing member in a direction perpendicular to a main surface of the transparent base, the phosphor-containing member has, in a direction perpendicular to the main surface of the transparent base, a thickness no greater than the wavelength of the incident light.
    Type: Grant
    Filed: February 17, 2017
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Kazuhiko Yamanaka, Norio Ikedo
  • Patent number: 9900730
    Abstract: In a method, when a first information terminal, which is provided with a wireless communication device capable of communicating with a first wireless communication device provided in a storage battery pack and which retains first identification information indicating a user of the storage battery pack, comes into close proximity with the first wireless communication device (S11), the first information terminal is registered in registration information as a first type of information terminal capable of altering the registration information, the registration information being stored in a storage device provided inside or outside of the storage battery pack, and being of information terminals capable of acquiring information relating to the storage battery pack stored in the storage device (S12).
    Type: Grant
    Filed: May 25, 2016
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventor: Go Kuroda
  • Patent number: 9896771
    Abstract: An exemplary dehydrogenation device for generating a hydrogen gas through dehydrogenation according to the present disclosure comprises an anode containing a dehydrogenation catalyst, a cathode containing catalyst capable of reducing protons, and a proton conductor disposed between the anode and the cathode. The proton conductor has a perovskite crystal structure expressed by the compositional formula AaB1-xB?xO3-?. The A element is an alkaline-earth metal and is contained in a range of 0.4<a<0.9, where the a value represents a mole fraction of this element, and the B? element is a trivalent group 3 or group 13 element and is contained in a range of 0.2<x<0.6, where the x value represents a mole fraction of this element.
    Type: Grant
    Filed: January 27, 2015
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Yuji Zenitani, Takashi Nishihara, Tetsuya Asano, Akihiro Itou, Hiroki Takeuchi
  • Patent number: 9897468
    Abstract: A processor of a position detection device intermittently performs an acquisition process during a measurement period to acquire a detection signal induced in a detection coil depending on the position of an object by driving an excitation coil. The processor configured to monitor whether or not the processor is executing the acquisition process without driving the excitation coil during a monitoring period set before the measurement period of the processor, and the processor is configured to execute a predetermined process when the processor is executing the acquisition process.
    Type: Grant
    Filed: February 23, 2015
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventors: Masahisa Niwa, Kunitaka Okada, Kazuma Haraguchi
  • Patent number: 9898041
    Abstract: The present invention relates to a docking station module for a computer docking station. The docking station module comprises a latching mechanism, the latching mechanism comprising a latch moveable between an unlatched position and a latched position, and a retainer moveable between a blocking position and an unblocked position. In the blocking position the retainer prevents movement of the latch to the unlatched position and in the unblocked position movement of the latch to the unlatched position is permitted. An actuator moves the retainer between the blocking and unblocked position. A connection surface is configured to enable the docking station module to be connected to a docking station cradle.
    Type: Grant
    Filed: October 13, 2015
    Date of Patent: February 20, 2018
    Assignee: Panasonic Manufacturing UK LTD
    Inventors: Robert Blowers, Joseph Preece, Darren Mong Hay
  • Patent number: 9898620
    Abstract: An information management method includes: receiving, from a manufacturer server via a network, device history information indicating a history of an operation of a device used by a first user and first anonymized user information generated by anonymizing, according to a predetermined rule, first user information including attribute information which allows identification of the first user; receiving, from a service provider server different from the manufacturer server via the network, service history information indicating a history of service used by a second user and second anonymized user information generated by anonymizing, according to the predetermined rule, second user information including attribute information which allows identification of the second user; and associating the device history information and the service history information and managing them as composite information, when the first anonymized user information and the second anonymized user information are determined to be identical
    Type: Grant
    Filed: September 18, 2013
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Yuji Unagami, Motoji Ohmori, Hideo Umetani, Michiko Sasagawa, Kazunori Isogai
  • Patent number: 9900567
    Abstract: An image display device includes a light source, a screen, an optical system, a screen driving mechanism unit, a memory unit, and a screen driving circuit unit. An image is formed on the screen by being irradiated with light from the light source. The screen driving mechanism unit moves the screen in an optical axis direction of the light. A smoothed movement profile is obtained by smoothing a movement profile used as a target for moving the screen so as to make a moving speed of the screen vary gently. The memory unit stores screen driving waveform information that has been generated so that the screen follows the smoothed movement profile. The screen driving circuit unit drives the screen driving mechanism unit, based on the screen driving waveform information stored in the memory unit.
    Type: Grant
    Filed: February 6, 2017
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventors: Susumu Uragami, Hiroyuki Furuya, Takahisa Shiramizu, Akira Kurozuka, Yuta Yamamoto
  • Patent number: 9899051
    Abstract: An information recording and playback device includes a recording and playback unit, and a controller. The controller divides a recording area of an optical disk into a first recording area which is at an inner circumference side, and a second recording area which is at an outer circumference side. The controller controls the recording and playback unit such that the unit records or plays back data in the first recording area at a first speed, and records or plays back data in the second recording area at a second speed slower than the first speed. The predetermined radius is set to a boundary between an area in which a control residual exceeds a predetermined reference value when servo control related to focusing and tracking is performed on the recording area of the optical disk, and an area in which the control residual does not exceed the predetermined reference value.
    Type: Grant
    Filed: December 3, 2015
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Harumitsu Miyashita, Akihito Yoshimi, Yoshihisa Takahashi
  • Patent number: 9898598
    Abstract: An authentication system comprises a host computer; and a non-volatile memory that includes a memory cell array including a plurality of memory cells are arranged in array, the plurality of memory cells including: a memory cell in a variable state, in which a resistance value reversibly changes between a plurality of changeable resistance value ranges in accordance with an electric signal applied; and a memory cell in an initial state which does not change to the variable state unless a forming stress for changing the memory cell in the initial state to the variable state is applied thereto, a resistance value of the memory cell in the initial state being within an initial resistance value range which does not overlap with the plurality of changeable resistance value ranges, wherein in the memory cell array, data including first authentication data is stored on the basis of whether each of the plurality of memory cells is in the initial state or the variable state, wherein at least one of the host computer an
    Type: Grant
    Filed: April 13, 2015
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventor: Yoshikazu Katoh
  • Patent number: 9899564
    Abstract: A Group III nitride semiconductor containing: a RAMO4 substrate containing a single crystal represented by the general formula RAMO4 (wherein R represents one or a plurality of trivalent elements selected from the group consisting of Sc, In, Y, and a lanthanoid element, A represents one or a plurality of trivalent elements selected from the group consisting of Fe(III), Ga, and Al, and M represents one or a plurality of divalent elements selected from the group consisting of Mg, Mn, Fe(II), Co, Cu, Zn, and Cd), and a Group III nitride crystal disposed above the RAMO4 substrate, having therebetween a dissimilar film that contains a material different from the RAMO4 substrate, and has plural openings.
    Type: Grant
    Filed: February 13, 2017
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventors: Akihiko Ishibashi, Akio Ueta
  • Patent number: 9898902
    Abstract: A method including: receiving multiple pieces of notice information; receiving detection information indicating whether or not the user is present around a speaker, notifying the user of content of first notice information in the multiple pieces of notice information by using the speaker, in a case that it is determined based on the detection information that the user is present around the speaker, and notifying the user of content of second notice information different from the first notice information, by using the speaker in a case that it is determined that the user is present around the speaker when the notification of the first notice information by using the speaker is complete.
    Type: Grant
    Filed: March 18, 2016
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Zarina Rafii, Yasuo Kohashi, Hiroko Sugimoto
  • Patent number: 9899577
    Abstract: A light-emitting apparatus comprising a photoluminescent layer that emits light in response to excitation light and has a light-emitting surface, the light from the photoluminescent layer being emitted through the light-emitting surface. The light-emitting surface includes a first region and a second region. The light from the photoluminescent layer includes first light having a wavelength ?a in air. The first light emitted through the first region has a smaller directional angle than the first light emitted through the second region.
    Type: Grant
    Filed: June 1, 2016
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Akira Hashiya, Taku Hirasawa, Yasuhisa Inada, Mikiko Matsuo
  • Patent number: 9898403
    Abstract: Disclosed is a nonvolatile storage system including: a memory block having a plurality of flash memories; a flash memory power supply circuit outside of the memory block; and a flash memory controller. The flash memory power supply circuit has a plurality of types of power supply circuits for process execution, the power supply circuits for process execution generating and supplying power at a plurality of voltage levels needed to execute processes in the flash memories. The flash memory controller monitors changes of the internal states of the flash memories by communicating with the flash memories, thereby controlling the power supply circuits for process execution and the flash memories.
    Type: Grant
    Filed: July 11, 2013
    Date of Patent: February 20, 2018
    Assignee: PANASONIC CORPORATION
    Inventors: Takayuki Tanaka, Keisuke Sakai, Makoto Matsumoto, Toshiki Mori, Yasuhiro Tomita, Seiji Yamahira
  • Patent number: 9899863
    Abstract: A coil module is disposed inside an electronic apparatus and receives prescribed power. The coil module includes a loop coil, a plate-like magnetic body that is disposed on the loop coil, and a conductive member that has prescribed conductivity and is disposed parallel with the plate-like magnetic body and on a surface, opposite to a surface on which the loop coil is disposed, of the magnetic body. The conductive member projects outward relative to at least a portion of a circumferential surface of the magnetic body.
    Type: Grant
    Filed: March 21, 2016
    Date of Patent: February 20, 2018
    Assignee: Panasonic Corporation
    Inventors: Takanori Hirobe, Yoshio Koyanagi, Hiroyuki Uejima
  • Patent number: 9899213
    Abstract: On an RAMO4 substrate containing a single crystal represented by the general formula RAMO4 (wherein R represents one or a plurality of trivalent elements selected from a group of elements including: Sc, In, Y, and a lanthanoid element, A represents one or a plurality of trivalent elements selected from a group of elements including: Fe(III), Ga, and Al, and M represents one or a plurality of divalent elements selected from a group of elements including: Mg, Mn, Fe(II), Co, Cu, Zn, and Cd), a buffer layer containing a nitride of In and a Group III element except for In is formed, and a Group III nitride crystal is formed on the buffer layer.
    Type: Grant
    Filed: February 9, 2017
    Date of Patent: February 20, 2018
    Assignee: PANASONIC CORPORATION
    Inventors: Akio Ueta, Akihiko Ishibashi
  • Patent number: 9899589
    Abstract: A thermoelectric power generation system of the present disclosure includes first and second thermoelectric power generation units. Each of the thermoelectric power generation units includes a plurality of tubular thermoelectric generators. The first and second thermoelectric power generation units are electrically connected to each other such that a first impedance caused by the tubular thermoelectric generator included in the first thermoelectric power generation unit is matched with a second impedance caused by the tubular thermoelectric generator included in the second thermoelectric power generation unit.
    Type: Grant
    Filed: December 17, 2014
    Date of Patent: February 20, 2018
    Assignee: PANASONIC CORPORATION
    Inventors: Hiromasa Tamaki, Tsutomu Kanno, Akihiro Sakai, Kohei Takahashi, Hideo Kusada, Yuka Yamada
  • Patent number: 9899506
    Abstract: Provided is a semiconductor device in which electron mobility is improved by applying sufficiently large tensile stress in a predetermined direction without occurrence of cracks in a nitride semiconductor. The semiconductor device includes: substrate (101), electron transit layer (103) that is disposed on substrate (101) and is formed by GaN; and electron supply layer (104) that is disposed on electron transit layer (103) and is formed by AlGaN. A coefficient of thermal expansion of substrate (101) is different between a first direction in a main surface of substrate (101) and a second direction that is perpendicular to the first direction in the main surface, and tensile stress occurs in electron transit layer (103).
    Type: Grant
    Filed: December 16, 2016
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Masahiro Ogawa, Masahiro Ishida, Daisuke Shibata, Ryo Kajitani
  • Patent number: 9899914
    Abstract: A lighting device includes a DC/DC converter, a drive circuit, and a delay circuit. The drive circuit generates a feedback signal and a PWM signal. The feedback signal indicates whether or not a voltage required for a constant current to flow in a solid-state light emitting device is applied to the solid-state light emitting device. The PWM signal indicates a current supply period during which a current flows in the solid-state light emitting device. The delay circuit delays at least one of a start timing and an end timing of the current supply period with respect to the PWM signal. The DC/DC converter includes: a switching element, and a control circuit which performs control such that the switching element switches in accordance with the feedback signal generated by the drive circuit, during an on-duty period determined by the PWM signal the timing of which has been delayed by the delay circuit.
    Type: Grant
    Filed: September 25, 2015
    Date of Patent: February 20, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventor: Jun Mizuno
  • Patent number: 9899911
    Abstract: A power source circuit includes first and second input terminals; first, second, and third inductors; first and second switching devices; first and second capacitors; and first and second output terminals. A first end of the second inductor is connected to a path that connects the first input terminal and the first node, a second end of the second capacitor is connected to a path that connects the second input terminal and the second node, and the first inductor and the second inductor are magnetically coupled with each other. A first end of the third inductor and a second end of the second inductor are connected to each other. A second end of the third inductor and a first end of the second capacitor are connected to each other.
    Type: Grant
    Filed: February 8, 2016
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Taiki Nishimoto, Akira Minegishi
  • Patent number: 9899680
    Abstract: The nonaqueous electrolyte secondary battery of the present invention includes a positive electrode, a negative electrode, a separator disposed between the positive electrode and the negative electrode, and a nonaqueous electrolyte. The positive electrode contains a positive electrode active material composed of a lithium-containing transition metal oxide having a layered crystal structure. The negative electrode contains a negative electrode active material composed of a Ti-based oxide and an additive composed of fluorinated carbon that reacts with lithium at a more noble potential as compared to the negative electrode active material. In the nonaqueous electrolyte secondary battery of the present invention, the battery voltage reaches a discharge cut-off voltage by a potential change in the negative electrode.
    Type: Grant
    Filed: March 26, 2013
    Date of Patent: February 20, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Tomoki Tsuji, Takayuki Shirane, Shinji Mino
  • Publication number: 20180048249
    Abstract: A power tool system includes a battery pack, a charger connectable to the battery pack, and a power tool body connectable to the battery pack. The battery pack includes a battery pack memory that stores identification information in a smallest unit allowing for communication with the charger and the power tool body. Each of the charger and the power tool body includes a device memory that stores at least one piece of identification information of a usable battery pack. Each of the charger and the power tool body or the battery pack includes a determination unit that determines whether or not the at least one piece of identification information stored in the device memory includes the identification information stored in the battery pack memory.
    Type: Application
    Filed: March 4, 2016
    Publication date: February 15, 2018
    Applicant: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Masaki IKEDA, Naoki TSURUTA, Akira KAWAI
  • Publication number: 20180048014
    Abstract: The present invention aims to provide a non-aqueous electrolyte secondary battery in which the amount of a gas generated during charge/discharge cycles, during storage, or the like is small although a cellulose-made separator is used. A non-aqueous electrolyte secondary battery which is one example of an embodiment includes a positive electrode including a positive electrode collector and a positive electrode mixture layer formed thereon; a negative electrode including a negative electrode collector and a negative electrode mixture layer formed thereon; a separator formed from a cellulose as a primary component; and a fluorine-containing non-aqueous electrolyte. In the positive electrode mixture layer, a lithium transition metal oxide and a phosphoric acid compound are contained.
    Type: Application
    Filed: April 13, 2016
    Publication date: February 15, 2018
    Applicant: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO. LTD.
    Inventors: Masanori Sugimori, Katsunori Yanagida, Natsumi Goto
  • Publication number: 20180043044
    Abstract: A disinfecting method includes irradiating fungi or bacteria with light including violet light having a light emission peak with (i) a full width at half maximum of at most 20 nm and (ii) a peak wavelength included in a range of from 380 nm to 410 nm, inclusive.
    Type: Application
    Filed: August 2, 2017
    Publication date: February 15, 2018
    Applicant: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Yoshiaki HACHIYA, Kazushige SUGITA, Takashi MANIWA, Makoto YAMADA
  • Publication number: 20180049279
    Abstract: A method for calibrating a set of devices, each device comprising an amplifying component and a measuring component that outputs a digital signal indicative of radio frequency power detected at the amplifying component, includes selecting a frequency from a set of frequencies; selecting a phase value from a set of phase values; selecting a power level from a set of power levels; setting a subset of the set of devices to output signal of the selected frequency, the selected phase value and the selected power level; measuring a forward power level and a backward power level; processing the measurements of the forward and backward power levels to calibrate the digital signal output from the measuring component of each of the set of devices; and encoding the calibrated digital signal output into non-volatile memory.
    Type: Application
    Filed: March 7, 2016
    Publication date: February 15, 2018
    Applicants: WHIRLPOOL CORPORATION, Panasonic Corporation
    Inventor: Davide Guatta
  • Publication number: 20180049278
    Abstract: A method for controlling an information terminal apparatus is disclosed. The method includes, receiving first display data indicating a condition to permit collecting selection information indicating recipe information selected by a user, and recipe information for selection. Once a recipe is selected by the user, selection information indicating selected recipe information is received. Based on the received information, a determination of whether the selected recipe information has a specific health identifier, and a determination of whether the user has granted a comprehensive permission for collecting the selection information under the indicated condition are made. When the selected recipe information is determined to include the specific health identifier and it is determined that the user has granted the comprehensive permission, the selected recipe information is uploaded to a server without requesting an individual permission from the user.
    Type: Application
    Filed: October 24, 2017
    Publication date: February 15, 2018
    Applicant: PANASONIC INTELLECTUAL PROPERTY CORPORATION OF AMERICA
    Inventors: Yuji UNAGAMI, Motoji OHMORI
  • Patent number: 9892740
    Abstract: A speech/audio coding apparatus is provided that includes a receiver that receives a time-domain speech input signal and a processor. The processor transforms a time-domain speech input signal into a frequency-domain spectrum, and divides a frequency region of the spectrum in an extended band into a plurality of bands. The processor also sets a limited band for each divided band in the current frame, when a difference between a first frequency with a first maximum amplitude in a spectrum of the divided band in a preceding frame and a second frequency with a second maximum amplitude in a spectrum of the divided band in a current frame is below a threshold. The processor further encodes the spectrum in the limited band within each divided band in the current frame, and does not encode a spectrum outside the limited band within each divided band in the current frame.
    Type: Grant
    Filed: May 9, 2017
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY CORPORATION OF AMERICA
    Inventors: Takuya Kawashima, Masahiro Oshikiri
  • Patent number: 9892859
    Abstract: A dispersion liquid including one of thiophene and derivatives thereof, a polyanion, and a solvent is prepared. The dispersion liquid is mixed with a first oxidizing agent producing iron ions so as to oxidatively polymerize the one of thiophene and derivatives thereof. At the completion of the polymerization, the conductive polymer microparticle dispersion contains trivalent iron ions with a concentration of 3 to 30 parts by weight, inclusive, with respect to 100 parts by weight of the conductive polymer microparticle.
    Type: Grant
    Filed: September 21, 2015
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Kazuhiro Takatani, Tatsuji Aoyama
  • Patent number: 9891434
    Abstract: An image display system includes a projector, a transparent screen, and a polarization adjuster. The projector projects image light. The transparent screen diffuses the image light that has been projected, to display an image. The polarization adjuster adjusts the image light that is to enter the transparent screen so that the image light is p-polarized.
    Type: Grant
    Filed: November 21, 2016
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Hiroshi Yamaguchi, Kazuhiro Yamada
  • Patent number: 9890027
    Abstract: An object is to allow the users to easily recognize where to put the beverage container for a corresponding nozzle even when multiple nozzles for dispensing beverages are present. Upon reception of a selection operation to select one beverage from options for multiple kinds of beverages displayed on a touch panel, a control section identifies the beverage supply port for dispensing the beverage selected by the selection operation among multiple beverage supply ports and controls the touch panel to indicate a container holder corresponding to the beverage supply port for dispensing the beverage.
    Type: Grant
    Filed: December 21, 2015
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Naoto Fukushima, Taiki Terada, Atsushi Makino
  • Patent number: 9890946
    Abstract: A steam generator includes: a water storage chamber which stores water therein, at least one heating portion which heats water in the water storage chamber to generate steam, a water supply device which supplies the water storage chamber with water, a steam spout port which spouts the steam generated in the water storage chamber therethrough, and a plurality of fins positioned below the steam spout port in a steam-generating direction and spaced from one another, wherein a first distance between the plurality of fins differs from a second distance between an inner wall side surface of the water storage chamber and the fins.
    Type: Grant
    Filed: March 13, 2014
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Masaki Shibuya, Yuji Hayakawa, Kuniaki Abe
  • Patent number: 9891003
    Abstract: A CHP system includes a combustor as a heat source, a Rankine cycle apparatus, a second heat exchanger, and a thermal fluid flow path. The Rankine cycle apparatus includes, as an evaporator, a first heat exchanger that absorbs thermal energy from combustion gas (thermal fluid). The second heat exchanger absorbs thermal energy from the combustion gas and transfers the thermal energy to a heat medium. The first heat exchanger and the second heat exchanger are disposed in the thermal fluid flow path. The thermal fluid flow path includes a first flow path that allows the combustion gas to reach the first heat exchanger directly from the combustor and a second flow path that allows the combustion gas to reach the second heat exchanger directly from the combustor.
    Type: Grant
    Filed: November 9, 2015
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Takumi Hikichi, Osao Kido, Atsuo Okaichi, Osamu Kosuda
  • Patent number: 9891514
    Abstract: A light source apparatus and a projection display apparatus according to the present disclosure include: a laser light source; and a multiplexing reflection mirror having a first surface on which a partial reflection coating having a predetermined reflectance is formed, and a second surface on which a total reflection coating is formed, the first surface and the second surface being opposite to each other and formed in a parallel flat shape. The multiplexing reflection mirror is disposed so as to incline toward an optical path of an emission light from the laser light source such that the emission light is incident from first surface.
    Type: Grant
    Filed: January 27, 2016
    Date of Patent: February 13, 2018
    Assignee: Panasonic Intellectual Property Management Co., Ltd.
    Inventors: Michihiro Okuda, Hiroshi Kitano
  • Patent number: 9894303
    Abstract: An imaging device includes: a first unit pixel cell including a first electrode, a second electrode facing the first electrode, a first photoelectric conversion layer between the first electrode and the second electrode, the first photoelectric conversion layer generating first signal charge, and a first signal detection circuit connected to the first electrode, the first signal detection circuit detecting the first signal charge; and a voltage supply circuit. The voltage supply circuit supplies a first voltage to the second electrode during a first period when the first unit pixel cell accumulates the first signal charge. The voltage supply circuit supplies a second voltage to at least one of the first electrode and the second electrode during a second period other than the first period, the second period including a first moment at which a difference in potential between the first electrode and the second electrode is zero.
    Type: Grant
    Filed: January 13, 2017
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventor: Yasuo Miyake
  • Patent number: 9892858
    Abstract: A method for manufacturing an electrolytic capacitor includes: a first step of preparing a capacitor element including an anode having a dielectric layer; a second step of impregnating the capacitor element with a first processing solution including at least a conductive polymer and a first solvent; and a third step of swelling the conductive polymer after the second step, by impregnating the capacitor element with a second processing solution including a swelling agent while at least part of the first solvent remains in the capacitor element.
    Type: Grant
    Filed: June 26, 2015
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Tatsuji Aoyama, Yukiya Shimoyama, Junya Kushizaki, Takuya Maruta
  • Patent number: 9893982
    Abstract: A routing control apparatus that constructs a transmission path for transmitting communication data in a wireless mesh network includes: a previous hop state managing unit that receives a first control signal for constructing a portion of the transmission path, and manages first information indicating operability, which is availability of a previous hop apparatus in a future, the portion being from a source apparatus to the routing control apparatus; an operation state managing unit that manages second information indicating operability of the routing control apparatus; and a routing control processing unit that compares the first information and the second information, and, if the operability of the routing control apparatus is higher than or equal to the operability of the previous hop apparatus, transmits a second control signal for constructing a remaining portion of the transmission path other than the portion.
    Type: Grant
    Filed: June 17, 2014
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY CORPORATION OF AMERICA
    Inventors: Hirokazu Kobayashi, Ryohei Kimura, Hiroyuki Sasaki
  • Patent number: 9892783
    Abstract: A non-volatile memory device comprises: a memory cell array that includes one or more memory groups each including memory cells, each of the memory cells having variable resistance value to hold a piece of data; a read circuit that, for each of the one or more memory groups, performs a read operation to obtain pieces of time information related to the memory cells in the memory group; and a data generation circuit that generates individual identification information on a basis of order of the memory cells in each of the one or more memory groups, the order corresponding to ascending order or descending order of the pieces of time information related to the memory cells in the memory group. The read circuit obtains each of the pieces of time information on a basis of a discharge phenomenon or charge phenomenon that depends on the resistance value of a corresponding one of the memory cells.
    Type: Grant
    Filed: May 12, 2017
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Yuhei Yoshimoto, Yoshikazu Katoh
  • Patent number: 9893356
    Abstract: The cathode active material for a nonaqueous electrolyte secondary battery according to an aspect of the present disclosure mainly comprises a compound represented by a composition formula: LixNay(Li?Na?Mn1????)O2, where x, y, ?, and ? satisfy 0.75?x?1.0, 0<y?0.01, 0.75<x+y?1, 0.16???0.3, 0???0.01, and 0.2??+??0.3.
    Type: Grant
    Filed: April 1, 2015
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Ryuichi Natsui, Kensuke Nakura
  • Patent number: 9889522
    Abstract: The laser processing head of the present disclosure includes a collimation lens, a focus lens, a first parallel plate, a first drive unit, a second parallel plate, and a second drive unit. The collimation lens collimates a laser beam having a first optical axis, and the focus lens condenses the collimated laser beam. The first parallel plate shifts the optical axis of the condensed laser beam to a second optical axis. The first drive unit rotates the first parallel plate around a first rotation axis. The second parallel plate shifts the optical axis of the laser beam shifted to the second optical axis, to a third optical axis. The second drive unit rotates the second parallel plate around a second rotation axis. The direction of the first rotation axis and the direction of the second rotation axis are identical.
    Type: Grant
    Filed: February 24, 2015
    Date of Patent: February 13, 2018
    Assignee: PANASONIC INTELLECTUAL PROPERTY MANAGEMENT CO., LTD.
    Inventors: Yiheng Kung, Yasushi Mukai, Wataru Takahashi
  • Patent number: D810152
    Type: Grant
    Filed: July 8, 2016
    Date of Patent: February 13, 2018
    Assignee: PANASONIC HEALTHCARE HOLDINGS CO., LTD.
    Inventors: Fumio Yamada, Akihiro Mochizuki, Tadashi Okada