Abstract: E. coli harboring the mutant plasmid pKGP-HA1mut4 and an inactive pCM-X# are chloramphenicol resistant and that the mutation responsible for the expression of CAT from the inactive pCM-X# plasmid is a G to A transition at nucleotide 664 of T7 gene 1 that converts glutamic acid (222) to lysine. This mutation expands the range of T7 promoter sequences that can be utilized by the enzyme. The mutant T7 RNA polymerase, GP1(lys222), utilizes inactive T7 promoter point mutants more efficiently than wild-type T7 RNA polymerase both in vivo and in vitro. Furthermore, the correlation of in vivo and in vitro promoter utilization suggests that the restoration of chloramphenicol resistance in the cotransformed E. coli results from the ability of GP1(lys222) to initiate transcription from T7 promoter point mutants that are normally inactive.

Abstract: New mutant glucose isomerases are provided exhibiting improved properties under application conditions. These glucose isomerases are obtained by expression of a gene encoding said enzyme, having an amino acid sequence which differs at least in one amino acid from the wildtype glucose isomerase. Preferred mutant enzymes are those derived from Actinoplanes missouriensis glucose isomerase.

Abstract: A cholesterol oxidase having a particular amino acid sequence and having a high substrate affinity and a working pH in an acidic range is produced by Brevibacterium sterolicum.

Abstract: L-Phenylalanyl-tRNA synthetase mutants, a process for the preparation thereof and the use thereof for the in vivo incorporation of non-proteinogenous amino acids into peptides or proteins.The invention relates to L-phenylalanyl-tRNA synthetases from microorganisms which, by reason of a modification generated by genetic engineering, have an altered substrate selectivity, and to their preparation and use for the in vivo incorporation of non-proteinogenous amino acids into peptides or proteins.

Abstract: An immunoassay for CK isoenzyme or CK isoform is provided based on capture of the CK isoenzyme or CK isoform by a specific antibody immobilized through a cleavable linker containing a disulfide bond onto a solid phase and release of the resulting antibody-CK isoenzyme or antibody-CK isoform complex by the addition of a reducing agent to cleave the disulfide bond and simultaneously activate the CK isoenzyme or CK isoform.

Abstract: The invention provides .alpha.-1-antichymotrypsin and protein preparations comprising human .alpha.-1-antichymotrypsin produced by E. coli cells transformed with a DNA sequence encoding human .alpha.-1-antichymotrypsin. The invention also provides methods for producing .alpha.-1-antichymotrypsin. The invention further provides analogues of .alpha.-1-antichymotrypsin that exhibit antichymotrypsin, anti-trypsin and anti-thrombin activity and methods of producing the analogues.

Abstract: A hybrid human/porcine coagulation factor VIII is produced by isolation and recombination of human and porcine factor VIII subunits, or by genetic engineering of the human and porcine factor VIII genes. Subunits of factor VIII that have been purified from human or porcine plasma are isolated, and hybrid human/porcine factor VIII is produced by mixing either porcine heavy chain subunits with human light chain subunits or by mixing human heavy chain subunits with porcine light chain subunits, thereby producing human light chain/porcine heavy chain and human heavy chain/porcine light chain hybrid molecules. These hybrid molecules are isolated by ion exchange chromatography. Alternatively, recombinant DNA methods are used to swap elements of porcine factor VIII for the corresponding elements of human factor VIII to produce hybrid human/porcine factor VIII.

Abstract: The present invention relates to a DNA profiling assay for detecting polymorphisms in a short tandem repeat. The method includes the steps of extracting DNA from a sample to be tested, amplifying the extracted DNA and identifying the amplified extension products for each different sequence. Each different sequence is differentially labeled. In the method, internal and external standards can also be used. The method is applicable to a wide variety of forensic and medical samples, including blood, semen, vaginal swaps, tissue, hair, saliva, urine and mixtures of body fluids. A short tandem repeat sequence which can be characterized by the formula (A.sub.w G.sub.x T.sub.y C.sub.z).sub.n, wherein A, G, T and C represent the nucleotides, w, x, y and z represent the number of nucleotide and range from 0 to 7 and the sum of w+x+y+z ranges from 3 to 7 and n represents the repeat number and ranges from 5 to 50.

Abstract: Fluorescent compounds useful in the determination of chloramphenicol acetyltransferase (CAT) enzyme activity are described. The compounds are "fluorescent derivatives related in structure to chloramphenicol and are acylated in the presence of CAT to produce fluorescent mono- and diacylated products, which are then physically separated from the reaction mixture and quantitated by means of their fluorescence and/or absorbance. Fluorescent molecules conjugated to chloramphenicol include derivatives of fluorescein, rhodamine, coumarin, dimethylaminonaph-thalene sulfonic acid (dansyl), pyrene, anthracene, nitrobenz-oxadiazole (NBD), acridine and dipyrrometheneboron difluoride.

Abstract: The present invention relates to a method of effecting the conjugative transfer of a mobilizable vector from cells of an E. coli mobilizer strain to gram-positive bacterial cells. The invention also relates to vectors suitable for use in such a method.

Abstract: A tissue factor protein mutant capable of neutralizing the ability of endogenous tissue factor to induce coagulation is provided. A representative tissue factor mutant designated K165A, K166A TF is useful in a method for inhibiting thrombin-induced platelet aggregation in a mammal, either separately or in combination with a thrombolytic agent, an anticoagulant, or a GPII.sub.b III.sub.a inhibitor.

Abstract: Recombinant protein purification vectors and methods for their use are disclosed. The vectors contain a DNA sequence coding for a gelatin binding region of fibronectin. The vectors express a foreign DNA sequence of interest fused to the fibronectin portion. Secretion signals on the fused product assist the product in being secreted from a production cell. The product can then be purified on a gelatin containing affinity column and digested with a protease such as trypsin to cleave the desired protein from the gelatin binding region. The vectors can also be designed to code for factor XIIIa cross liking sites and to have a chemically reactive cysteine residue.

Abstract: A method and kit, employing exo-sample nucleotides such as deoxyuridine, capable of altering the nucleic acid sequence present at the 3' or 5' end of a DNA or RNA molecule is provided. The method and kit can be used to achieve the selective amplification of nucleic acid molecules.

Abstract: Fibrin binding peptides disclosed include (a) peptides having the amino acid sequence of a human Blood Coagulation Factor XIIIA fragment (i.e., NKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDR SVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFY GEVNDIKTRSWSYGQF-R', where R, is --CONH.sub.2 or --NH.sub.2); (b) peptides which are fragments of the foregoing Factor XIIIA fragment and which retain the capability thereof of binding to fibrin; and (c) peptides which bind to fibrin, which have the amino acid sequence of any of the foregoing peptides, and which have additional amino acid residues attached to the N-terminal end and/or the C-terminal end thereof.The peptides are useful for localizing blood clots in vivo, inhibiting fibrin stabilization, and promoting thrombolysis.

Abstract: A method for producing MAP utilizing a gene which is formed by combining a gene coding for E.coli outer membrane protein OmpA signal peptide upstream of MAP gene as a foreign gene. In this method, said gene is inserted in a plasmid having E.coli expression systems and the recombinant plasmid obtained is introduced into E.coli for transformation.

Abstract: Fusaric acid resistant genes derived from fusaric acid decomposing or detoxifying microorganisms such as Pseudomonas cepacia and Klebsiella oxytoca are described. Also described are DNA fragments and plasmids, which comprise such fusaric acid resistant genes. Host cells comprising such plasmids are also described.

Abstract: This invention relates to analogs of thrombolytic agents having a modified kringle domain. More specifically, this invention is directed to TPA type compounds wherein modifications occur in the kringle 1 and kringle 2 domains. This invention is also directed to analogs with one or more changes in the kringle domain of urokinase-type compounds. The compounds of this invention are pharmaceutically useful having particular use in the same manner as TPA and urokinase.

Abstract: Provided are ribosome binding sites having an increased number of adenine (A) and thymidine (T) residues as compared to the naturally occurring ribosome binding sites from which they are derived or to which they are related, which allow high level expression of genes encoding heterologous polypeptides, particularly somatotropins, operatively linked thereto.

Abstract: A methionine N.sup..alpha. -acetyltransferase enzyme has been identified in yeast. The existence of the enzyme defines a gene for methionine N.sup..alpha. -acetyltransferase which may be cloned and altered. Cells expressing the normal or variant forms of this enzyme are valuable tools for determining the amino acid sequence of uncharacterized proteins. Such cells are also valuable tools for expressing a recombinant protein lacking an acetyl group at its .alpha.-amino group.

Abstract: A method for the recombinant production of zymogen forms of human protein C is described. These zymogen forms differ from native zymogen protein C in their increased sensitivity to activation by thrombin and thrombin/thrombomodulin. DNA compounds, vectors, and transformants useful in the method are also disclosed.