Abstract: The present invention relates to a novel exenatide analogue, which is an exenatide analogue in which the first to fifteenth amino acids from the C-terminal of the amino acid sequence of exenatide are deleted and a fatty acid is conjugated. The present invention provides a short length exenatide exhibiting almost the same level of anti-diabetic effects compared with that of conventional exenatide and liraglutide, which is an anti-diabetic drug, and capable of reducing the preparation cost of exenatide.

Abstract: The present invention provides a Mitrecin A polypeptide useful in prevention and treatment of one or more bacteria. Also provided is a method to kill or prevent growth of one or more bacteria comprising contacting the one or more bacteria with a Mitrecin A polypeptide. The target bacteria can be selected from the group consisting of a Gram-positive bacterium, a Gram-negative bacterium, or both. In one embodiment, the present invention is drawn to a polynucleotide encoding a Mitrecin A polypeptide, a vector comprising the polynucleotide, a host cell comprising the polynucleotide, or a composition comprising the Mitrecin A polypeptide, the polynucleotide, the vector, or the host cell.

Abstract: Compositions comprising iron-sequestering glycoproteins, chelating agents, stabilizing agents, binding agents, surfactants, fluorides, antimicrobials and a pH adjuster or buffer for the prevention and treatment of oral cavity diseases caused by dental plaque/biofilm, such as dental caries, gingivitis and periodontitis, through anti-infective properties are disclosed. The anti-infective properties of a composition include reduction or killing of anaerobic/aerobic/facultative gram-negative and gram-positive oral bacteria occurring in polymicrobial dental biofilms. The composition may be in the form of wash, rinse, soak, paste, gel, spray, or other suitable form. Additionally, the invention offers an efficient method of delivering the formulated composition containing a PEGylated or fluorinated iron-sequestering glycoprotein and one or two chelating agents or chelating agents alone using either a liposomal or a nanoparticle delivery system.

Abstract: Disclosed are novel peptides comprising SEQ ID NO: 1 and modifications thereof, which are effective in blocking leukocyte recruitment. The disclosed peptides are useful for treating diseases associated with leukocyte recruitment for example inhibiting metastasis of a solid tumor to the liver and lungs and for treating sepsis. Also disclosed are methods of screening for compounds having the ability to block leukocyte recruitment.

Abstract: De novo artificial protein based reporters that may be expressed in eukaryotic (e.g., mammalian) cells and methods of using the same are provided herein.

Abstract: Disclosed are a conjugate including a mitochondria-targeting moiety and a peptide molecule capable of self-assembly; and a pharmaceutical composition for preventing or treating cancer including the conjugate as an active ingredient.

Abstract: Provided are non-naturally occurring cystine knot peptides (CKPs) that bind to VEGF-A. Additionally, provided are methods of using non-naturally occurring CKPs that bind to VEGF-A, including diagnostic and therapeutic compositions and methods. Non-naturally CKPs that bind low density lipoprotein receptor-related protein 6 (LRP6) are also provided.

Abstract: The present invention provides for engineered molecular opsonins that may be used to bind biological pathogens or identify subclasses or specific pathogen species for use in devices and systems for treatment and diagnosis of patients with infectious diseases, blood-borne infections or sepsis. An aspect of the invention provides for mannose-binding lectin (MBL), which is an abundant natural serum protein that is part of the innate immune system. The ability of this protein lectin to bind to surface molecules on virtually all classes of biopathogens (viruses, bacteria, fungi, protozoans) make engineered forms of MBL extremely useful in diagnosing and treating infectious diseases and sepsis.

Abstract: The present invention provides for engineered molecular opsonins that may be used to bind biological pathogens or identify subclasses or specific pathogen species for use in devices and systems for treatment and diagnosis of patients with infectious diseases, blood-borne infections or sepsis. An aspect of the invention provides for mannose-binding lectin (MBL), which is an abundant natural serum protein that is part of the innate immune system. The ability of this protein lectin to bind to surface molecules on virtually all classes of biopathogens (viruses, bacteria, fungi, protozoans) make engineered forms of MBL extremely useful in diagnosing and treating infectious diseases and sepsis.

Abstract: Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.

Abstract: The invention relates to therapeutic and cosmetic uses of calreticulin including reducing eliminating wrinkles and/or fine lines, tissue repair and reconstruction, repairing damaged and/or cartilage, stimulating regeneration of an epidermal appendage, enhancing phagocytosis of bacteria by phagocytes within a wound, treating a wound in a patient suffering delayed wound healing, treating a corneal wound, and treating or preventing a surgical adhesion.

Abstract: Provided herein are polypeptides containing stabilized BH4 domains of BCL-2 family proteins that are capable of binding and/or inactivating and/or modulating BAX protein, and/or its close homologues BAK and BOK, and/or other physiological BH4 targets. Also provided are compositions containing these polypeptides and methods of treating cytotoxic diseases that include administering to a subject one of the polypeptides.

Abstract: The present invention relates to compositions and methods for preventing and reducing inflammation and preventing and treating diseases and disorders associated with inflammation. It has been shown that CRADD plays a pivotal role in maintaining the integrity of endothelial monolayers. The recombinant cell-penetrating CRADD protein (CP-CRADD)-based compositions and methods described herein provide for the development of a novel treatment for inflammatory vascular disorders including cardiovascular, cerebrovascular, respiratory, gastrointestinal, and renal systems.

Abstract: The present disclosure relates to methods of using a compound to induce regeneration of hematopoietic stem cells or increase the recovery of red blood cells. In some aspects, the present methods can be used to with or in place of erythropoietin in patients to mitigate the side effects of erythropoietin.

Abstract: An insulin analogue comprises an insulin A-chain polypeptide and an insulin B-chain polypeptide. The A-chain polypeptide contains a Glu substitution at a position corresponding to position A8, and an Ala, Glu, Gln, His, Tyr, Phe or Trp substitution at a position A13, relative to wild type insulin. The B-chain polypeptide contains a cyclohexanylalanine substitution at position B24, relative to wild type insulin. The analogue may be an analogue of a mammalian insulin, such as human insulin. A nucleic acid encoding such an insulin analogue is also provided. A method of lowering the blood sugar of a patient comprises administering a physiologically effective amount of the insulin analogue or a physiologically acceptable salt thereof to a patient.

Abstract: Physically stable compositions in the form of an injectable aqueous solution, wherein the pH is from 6.0 to 8.0, includes at least: a) human glucagon and b) a co-polyamino acid bearing carboxylate charges and hydrophobic radicals Hy. In one embodiment, the compositions further comprise a gut hormone.

Abstract: The present invention relates to a foodstuff comprising feather hydrolysate for use in improving performance during exercise and/or improving recovery after exercise in a dog. It also relates to a method of improving the performance in a dog during exercise and/or improving recovery after exercise, the method comprising administering to a dog a foodstuff which comprises feather hydrolysate.

Abstract: Compositions comprising a mixture of proteins derived from MaSP, nucleic acids encoding same and method for the preparation of synthetic dragline spider silk are provided. The compositions of the invention comprise a mixture of proteins of differing molecular weight, wherein each protein of said mixture comprises, independently, multiple repeats of a repetitive region of a MaSP (major ampullate spidroin) protein or a functional homolog, variant, derivative or fragment thereof.

Abstract: Methods of treating liver diseases are provided. Accordingly there is provided a method of treating a liver disease selected from the group consisting of fatty liver disease and chronic liver rejection in a subject in need thereof, wherein said liver disease is not associated with genetic alpha-1 anti-trypsin (AAT) deficiency, the method comprising administering to the subject a therapeutically effective amount of AAT.

Abstract: Disclosed herein are methods of using PRG4 glycoprotein, also known as lubricin, to reduce, inhibit, or down-regulate pro-inflammatory pathways in patients at risk of or suffering from an inflammatory response or allergy symptom through CD44 antagonization, regulating pro-inflammatory cytokine production, inhibiting NF-?B translocation and/or facilitating removal of inflammation-inducing cellular or matrix debris or allergens.