Abstract: The present invention relates to an isolated nucleic acid fragment comprising a nucleic acid sequence encoding a lepidopteran sodium channel, or portion thereof.

Abstract: A new type of dominant negative gene-fusion acts as an antiviral agent when expressed in infected cells. The dominant negative effect is obtained by fusing a gene coding for a capsid or envelope protein of a virus to a gene coding for an enzyme (e.g., nuclease or protease) that can destructively hydrolyze or modify the encapsulated viral DNA, RNA or proteins. The fusion gene is expressed in virally infected cells; viruses assembled in these cells will then "self-destruct" because the fusion enzyme incorporated in the viral particles destroys or functionally alters essential components of the virus, thus preventing the virus from productively infecting another cell.

Abstract: The present invention concerns a process for the isolation of recombinant IgA protease from inclusion bodies. In addition a recombinant DNA is claimed which codes for an IgA protease whose C-terminal helper sequence and preferably also its N-terminal signal sequence is no longer active.

Abstract: The invention relates to antigenic preparations useful for inducing the production of antibodies in an individual which will bind to epitopes on zona pellucida. Also disclosed are immunogenic compositions and methods for immunizing an individual to enable the production of antibodies to zona pellucida antigens. Also disclosed are the use of these recombinant molecules and monoclonal antibodies thereto for immunocontraception or sterilization.

Abstract: The invention concerns a melanoma-inhibiting protein, nucleic acid sequences coding for this protein, process for the isolation of this protein as well as its use for the production of a therapeutic agent.

Abstract: The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.

Abstract: A novel insecticidal protein isolated from Bacillus thuringiensis var. galleria is described and its DNA sequence is given. This protein, called CryIC(b), is toxic to Lepidoptera, including Spodoptera.

Abstract: Human elastase IV polypeptides and DNA (RNA) encoding such polypeptides and a procedure for producing such polypeptide by recombinant techniques and utilizing such polypeptide for therapeutic purposes, for example, restoration of elasticity of arterial walls, improvement of serum lipid abnormality and improvement of serum lipoprotein metabolism are disclosed. Also disclosed are antagonist/inhibitors against such polypeptides and their use in treating inflammation, arthritis, e.g. rheumatoid arthritis and osteoarthritis, septic shock, pancreatitis and limiting tissue damage in ulceration.

Abstract: A Bcl-2 associated protein (Bax) and uses thereof.

Abstract: Substantially pure C. albicans topoisomerase I protein is disclosed. Nucleic acid molecules that encode C. albicans topoisomerase I protein, recombinant expression vectors that comprise a nucleic acid sequence that encodes C. albicans topoisomerase I protein, and host cells that comprise recombinant expression vectors that comprise nucleic acid sequences that encode C. albicans topoisomerase I protein are disclosed. Fragments of nucleic acid molecules with sequences encoding C. albicans topoisomerase I protein and oligonucleotide molecules that comprise a nucleotide sequence complimentary to fragment of a nucleotide sequence that encodes C. albicans topoisomerase I protein are disclosed. Antibodies which bind to an epitope on C. albicans topoisomerase I protein are disclosed. Methods of identifying inhibitors of C. albicans topoisomerase I protein are disclosed.

Abstract: This invention relates to the purification of a family of insecticidally effective peptides isolated from the spider, Calisoga sp., characterized by their neurotoxic effect on insect pest and low mammalian toxicity. The cDNA sequences for three of these peptides have been isolated, and the complete coding sequence is provided. This invention also discloses methods for producing recombinant peptides, as well as methods of utilizing these peptides as insecticidal agents.

Abstract: A gene encoding a protease derived from human serum and having an activity to convert single-chain hepatocyte growth factor (HGF) into active two-chain HGF and a method of producing the protease by the use of said gene are provided. A method of producing a precursor protein of said protease is also provided.

Abstract: An isolated gene encoding all or part of the VP7 protein of human rotavirus serotype 4 is claimed. Also claimed in a DNA transfer vector which contains the gene or a portion or sub-unit and a host cell contg. the DNA transfer vector.

Abstract: A process for obtaining Herpes Simplex virus type 1 (HSV-1) glycoprotein I (gI) from cells which have been infected or transformed with a recombinant Baculovirus is disclosed. The gI produced is then isolated and purified for use in immunotherapy against HSV infections.

Abstract: The present invention provides nucleotide sequences encoding proteins and fragments thereof that bind to Bcl-2-related proteins. The invention also provides a Bcl-2-associated protein (BAP) such as Bcl-2-associated protein-1 (BAP-1), which binds to Bcl-2. The invention also provides antibodies that specifically bind to a BAP. The invention further provides methods for detecting agents such as drugs that alter the binding of a BAP such as BAP-1 or Raf-related protein with a Bcl-2-related protein and methods for detecting agents that induce dissociation of a bound complex formed by the association of a BAP and a Bcl-2-related protein. The invention further provides methods for modulating the activity of a Bcl-2-related protein in a cell by introducing into the cell a nucleic acid encoding a BAP or by introducing into the cell an antisense nucleotide sequence, which is complementary to a region of a gene encoding a BAP.

Abstract: The present invention relates to a gene derived from Pseudomonas chlororaphis B23 strain which encodes a polypeptide having nitrile hydratase activity being capable of hydrating nitriles to amides. The invention also relates to a recombinant DNA containing the gene, and a transformant transformed with the recombinant DNA. The present invention further relates to a method of producing nitrile hydratase using the transformant and of amides using nitrile hydratase.

Abstract: Provided is a fusion molecule comprising a DNA sequence encoding a thioredoxin-like protein fused to a DNA sequence encoding a second peptide or protein. The peptide or protein may be fused to the amino terminus of the thioredoxin-like molecule, the carboxyl terminus of the thioredoxin-like molecule, or within the thioredoxin-like molecule, for example at the active-site loop of said molecule. The fusion molecule may be modified to introduce one or more metal-binding/chelating amino-acid residues to aid in purification. Expression of this fusion molecule under the control of a regulatory sequence capable of directing its expression in a desired host cell, produces high levels of stable and soluble fusion protein. The fusion protein, located in the bacterial cytoplasm, may be selectively released from the cell by osmotic shock or freeze/thaw procedures. It may be optionally cleaved to liberate the soluble, correctly folded heterologous protein from the thioredoxin-like portion.

Abstract: The invention is directed to A-lineage conotoxin peptides, which are conotoxin peptides that have strong homology in the signal sequence and the 3'-untranslated region of the genes coding for these peptides to the sequences in the .alpha.-conotoxin peptides. The A-lineage conotoxin peptides include the .alpha.-conotoxin peptides, the .alpha.-conotoxin-like peptides and the .kappa.-conotoxin peptides, described further below. The .alpha.-conotoxin-peptides generally share a "core" sequence motif. This core sequence is termed the .alpha.3/5 core and is represented as Cys-Cys-Xaa-Xaa-Xaa- Cys-Xaa-Xaa-Xaa-Xaa-Xaa-Cys (SEQ ID NO:1). The .alpha.-conotoxin-like peptides generally share a core sequence termed the .alpha.4/7 core and is represented as Cys-Cys-Xaa-Xaa-Xaa-Xaa-Cys-Xaa- Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Cys (SEQ ID NO:2). The .kappa.-conotoxin peptides generally have a core sequence termed the .kappa.

Abstract: A membrane protein related to human programmed cell death (PD-1) and DNA encoding the said protein is provided. PD-1 protein may be useful for the treatment of various infections, immunological depression or acceleration, or tumors etc.

Abstract: BCRF1 proteins are provided for treating conditions associated with excessive production of IFN-.gamma.. Also provided are expression vectors for producing BCRF1 proteins. Compositions of the invention are useful in treating a variety of disorders, including allergy, psoriasis, tissue rejection, and MHC-linked autoimmune diseases.