Patents Examined by G. E. Bugaisky
  • Patent number: 5989886
    Abstract: A new type of dominant negative gene-fusion acts as an antiviral agent when expressed in infected cells. The dominant negative effect is obtained by fusing a gene coding for a capsid or envelope protein of a virus to a gene coding for an enzyme (e.g., nuclease or protease) that can destructively hydrolyze or modify the encapsulated viral DNA, RNA or proteins. The fusion gene is expressed in virally infected cells; viruses assembled in these cells will then "self-destruct" because the fusion enzyme incorporated in the viral particles destroys or functionally alters essential components of the virus, thus preventing the virus from productively infecting another cell.
    Type: Grant
    Filed: January 2, 1991
    Date of Patent: November 23, 1999
    Assignee: The Johns Hopkins University
    Inventors: Jef D Boeke, Georges Natsoulis
  • Patent number: 5965424
    Abstract: The present invention concerns a process for the isolation of recombinant IgA protease from inclusion bodies. In addition a recombinant DNA is claimed which codes for an IgA protease whose C-terminal helper sequence and preferably also its N-terminal signal sequence is no longer active.
    Type: Grant
    Filed: March 18, 1994
    Date of Patent: October 12, 1999
    Assignee: Boehringer Mannheim GmbH
    Inventors: Dorothea Ambrosius, Carola Dony, Rainer Rudolph
  • Patent number: 5820863
    Abstract: The invention relates to antigenic preparations useful for inducing the production of antibodies in an individual which will bind to epitopes on zona pellucida. Also disclosed are immunogenic compositions and methods for immunizing an individual to enable the production of antibodies to zona pellucida antigens. Also disclosed are the use of these recombinant molecules and monoclonal antibodies thereto for immunocontraception or sterilization.
    Type: Grant
    Filed: February 28, 1995
    Date of Patent: October 13, 1998
    Assignee: Zonagen, Inc.
    Inventor: Bonita Sue Dunbar
  • Patent number: 5770366
    Abstract: The invention concerns a melanoma-inhibiting protein, nucleic acid sequences coding for this protein, process for the isolation of this protein as well as its use for the production of a therapeutic agent.
    Type: Grant
    Filed: January 19, 1996
    Date of Patent: June 23, 1998
    Assignee: Boehringer Mannheim GmbH
    Inventors: Ulrich Bogdahn, Reinhard Burrner, Brigitte Kaluza
  • Patent number: 5756460
    Abstract: The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.
    Type: Grant
    Filed: July 25, 1995
    Date of Patent: May 26, 1998
    Assignee: Garvan Institute of Medical Research
    Inventors: Helen Frances Evans, John Shine
  • Patent number: 5712248
    Abstract: A novel insecticidal protein isolated from Bacillus thuringiensis var. galleria is described and its DNA sequence is given. This protein, called CryIC(b), is toxic to Lepidoptera, including Spodoptera.
    Type: Grant
    Filed: May 4, 1995
    Date of Patent: January 27, 1998
    Assignee: Sandoz LTD.
    Inventors: Sue S. Kalman, Kristine L. Kiehne
  • Patent number: 5710035
    Abstract: Human elastase IV polypeptides and DNA (RNA) encoding such polypeptides and a procedure for producing such polypeptide by recombinant techniques and utilizing such polypeptide for therapeutic purposes, for example, restoration of elasticity of arterial walls, improvement of serum lipid abnormality and improvement of serum lipoprotein metabolism are disclosed. Also disclosed are antagonist/inhibitors against such polypeptides and their use in treating inflammation, arthritis, e.g. rheumatoid arthritis and osteoarthritis, septic shock, pancreatitis and limiting tissue damage in ulceration.
    Type: Grant
    Filed: July 5, 1994
    Date of Patent: January 20, 1998
    Assignee: Human Genome Sciences, Inc.
    Inventors: John M. Greene, Mark D. Adams
  • Patent number: 5691187
    Abstract: Substantially pure C. albicans topoisomerase I protein is disclosed. Nucleic acid molecules that encode C. albicans topoisomerase I protein, recombinant expression vectors that comprise a nucleic acid sequence that encodes C. albicans topoisomerase I protein, and host cells that comprise recombinant expression vectors that comprise nucleic acid sequences that encode C. albicans topoisomerase I protein are disclosed. Fragments of nucleic acid molecules with sequences encoding C. albicans topoisomerase I protein and oligonucleotide molecules that comprise a nucleotide sequence complimentary to fragment of a nucleotide sequence that encodes C. albicans topoisomerase I protein are disclosed. Antibodies which bind to an epitope on C. albicans topoisomerase I protein are disclosed. Methods of identifying inhibitors of C. albicans topoisomerase I protein are disclosed.
    Type: Grant
    Filed: June 7, 1995
    Date of Patent: November 25, 1997
    Assignee: Thomas Jefferson University
    Inventors: Eric B. Kmiec, David L. Gerhold, Allyson Cole Strauss
  • Patent number: 5691179
    Abstract: A Bcl-2 associated protein (Bax) and uses thereof.
    Type: Grant
    Filed: August 26, 1993
    Date of Patent: November 25, 1997
    Assignee: Washington University
    Inventor: Stanley J. Korsmeyer
  • Patent number: 5688764
    Abstract: This invention relates to the purification of a family of insecticidally effective peptides isolated from the spider, Calisoga sp., characterized by their neurotoxic effect on insect pest and low mammalian toxicity. The cDNA sequences for three of these peptides have been isolated, and the complete coding sequence is provided. This invention also discloses methods for producing recombinant peptides, as well as methods of utilizing these peptides as insecticidal agents.
    Type: Grant
    Filed: February 17, 1995
    Date of Patent: November 18, 1997
    Assignee: NPS Pharmaceuticals, Inc.
    Inventors: Janice H. Johnson, Robert M. Kral, Jr., Karen Krapcho
  • Patent number: 5677164
    Abstract: A gene encoding a protease derived from human serum and having an activity to convert single-chain hepatocyte growth factor (HGF) into active two-chain HGF and a method of producing the protease by the use of said gene are provided. A method of producing a precursor protein of said protease is also provided.
    Type: Grant
    Filed: May 24, 1995
    Date of Patent: October 14, 1997
    Assignee: Mitsubishi Chemical Corporation
    Inventors: Takeshi Shimomura, Kazunori Yamada, Yuuki Morimoto, Naomi Kitamura, Keiji Miyazawa
  • Patent number: 5672349
    Abstract: A process for obtaining Herpes Simplex virus type 1 (HSV-1) glycoprotein I (gI) from cells which have been infected or transformed with a recombinant Baculovirus is disclosed. The gI produced is then isolated and purified for use in immunotherapy against HSV infections.
    Type: Grant
    Filed: September 22, 1994
    Date of Patent: September 30, 1997
    Assignee: Cedars Sinai Medical Center
    Inventors: Anthony Bart Nesburn, Steven Lewis Wechsler, Homayon Ghiasi
  • Patent number: 5672684
    Abstract: An isolated gene encoding all or part of the VP7 protein of human rotavirus serotype 4 is claimed. Also claimed in a DNA transfer vector which contains the gene or a portion or sub-unit and a host cell contg. the DNA transfer vector.
    Type: Grant
    Filed: July 25, 1994
    Date of Patent: September 30, 1997
    Assignees: The University of Sydney, The University of Melbourne
    Inventors: Michael Leigh Dyall-Smith, Chris Hum, Ian Hamilton Holmes, Michael Anthony Johnson, Peter Richard Reeves
  • Patent number: 5650491
    Abstract: The present invention provides nucleotide sequences encoding proteins and fragments thereof that bind to Bcl-2-related proteins. The invention also provides a Bcl-2-associated protein (BAP) such as Bcl-2-associated protein-1 (BAP-1), which binds to Bcl-2. The invention also provides antibodies that specifically bind to a BAP. The invention further provides methods for detecting agents such as drugs that alter the binding of a BAP such as BAP-1 or Raf-related protein with a Bcl-2-related protein and methods for detecting agents that induce dissociation of a bound complex formed by the association of a BAP and a Bcl-2-related protein. The invention further provides methods for modulating the activity of a Bcl-2-related protein in a cell by introducing into the cell a nucleic acid encoding a BAP or by introducing into the cell an antisense nucleotide sequence, which is complementary to a region of a gene encoding a BAP.
    Type: Grant
    Filed: June 5, 1995
    Date of Patent: July 22, 1997
    Assignee: La Jolla Cancer Research Foundation
    Inventors: John C. Reed, Shinichi Takayama, Takaaki Sato
  • Patent number: 5648256
    Abstract: The present invention relates to a gene derived from Pseudomonas chlororaphis B23 strain which encodes a polypeptide having nitrile hydratase activity being capable of hydrating nitriles to amides. The invention also relates to a recombinant DNA containing the gene, and a transformant transformed with the recombinant DNA. The present invention further relates to a method of producing nitrile hydratase using the transformant and of amides using nitrile hydratase.
    Type: Grant
    Filed: April 22, 1994
    Date of Patent: July 15, 1997
    Assignee: Nitto Chemical Industry Co., Ltd.
    Inventors: Hideaki Yamada, Toru Nagasawa, Teruhiko Beppu, Sueharu Horinouch, Makoto Nishiyama
  • Patent number: 5646016
    Abstract: Provided is a fusion molecule comprising a DNA sequence encoding a thioredoxin-like protein fused to a DNA sequence encoding a second peptide or protein. The peptide or protein may be fused to the amino terminus of the thioredoxin-like molecule, the carboxyl terminus of the thioredoxin-like molecule, or within the thioredoxin-like molecule, for example at the active-site loop of said molecule. The fusion molecule may be modified to introduce one or more metal-binding/chelating amino-acid residues to aid in purification. Expression of this fusion molecule under the control of a regulatory sequence capable of directing its expression in a desired host cell, produces high levels of stable and soluble fusion protein. The fusion protein, located in the bacterial cytoplasm, may be selectively released from the cell by osmotic shock or freeze/thaw procedures. It may be optionally cleaved to liberate the soluble, correctly folded heterologous protein from the thioredoxin-like portion.
    Type: Grant
    Filed: December 10, 1993
    Date of Patent: July 8, 1997
    Assignee: Genetics Institute, Inc.
    Inventors: John McCoy, Elizabeth DiBlasio-Smith, Kathleen Grant, Edward R. LaVallie
  • Patent number: 5633347
    Abstract: The invention is directed to A-lineage conotoxin peptides, which are conotoxin peptides that have strong homology in the signal sequence and the 3'-untranslated region of the genes coding for these peptides to the sequences in the .alpha.-conotoxin peptides. The A-lineage conotoxin peptides include the .alpha.-conotoxin peptides, the .alpha.-conotoxin-like peptides and the .kappa.-conotoxin peptides, described further below. The .alpha.-conotoxin-peptides generally share a "core" sequence motif. This core sequence is termed the .alpha.3/5 core and is represented as Cys-Cys-Xaa-Xaa-Xaa- Cys-Xaa-Xaa-Xaa-Xaa-Xaa-Cys (SEQ ID NO:1). The .alpha.-conotoxin-like peptides generally share a core sequence termed the .alpha.4/7 core and is represented as Cys-Cys-Xaa-Xaa-Xaa-Xaa-Cys-Xaa- Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Cys (SEQ ID NO:2). The .kappa.-conotoxin peptides generally have a core sequence termed the .kappa.
    Type: Grant
    Filed: June 7, 1995
    Date of Patent: May 27, 1997
    Assignee: University of Utah Research Foundation
    Inventors: Baldomero M. Olivera, Lourdes J. Cruz, David R. Hillyard, J. Michael McIntosh, Ameurfino O. Santos
  • Patent number: 5629204
    Abstract: A membrane protein related to human programmed cell death (PD-1) and DNA encoding the said protein is provided. PD-1 protein may be useful for the treatment of various infections, immunological depression or acceleration, or tumors etc.
    Type: Grant
    Filed: March 1, 1995
    Date of Patent: May 13, 1997
    Assignees: Ono Pharmaceutical Co., Ltd., Tasuku Honjo
    Inventors: Tasuku Honjo, Yasumasa Ishida, Takashi Shinohara
  • Patent number: 5627155
    Abstract: BCRF1 proteins are provided for treating conditions associated with excessive production of IFN-.gamma.. Also provided are expression vectors for producing BCRF1 proteins. Compositions of the invention are useful in treating a variety of disorders, including allergy, psoriasis, tissue rejection, and MHC-linked autoimmune diseases.
    Type: Grant
    Filed: May 26, 1995
    Date of Patent: May 6, 1997
    Assignee: Schering Corporation
    Inventors: Kevin W. Moore, Robert A. Kastelein
  • Patent number: 5622852
    Abstract: The invention provides a bcl-2 related protein, Bad, Bad muteins, two-hybrid systems comprising interacting Bad polypeptide sequences, Bad polynucleotides, and uses thereof.
    Type: Grant
    Filed: October 31, 1994
    Date of Patent: April 22, 1997
    Assignee: Washington University
    Inventor: Stanley J. Korsmeyer