Abstract: Staphylococcal enterotoxins obtained by secretion from Staphylococcus aureus, by expression of enterotoxins in other bacteria or cells, or by chemical mutagenic treatment of Staphlococcus aureus strains are used in treatment of cancer as tumoricidal agents. Enterotoxins A, B, C, D, E and toxic shock toxin (TSST-1) can be administered via simple intravenous injection or in the form of adjuvants such as pluronic triblock copolymers. Enterotoxins may also be used ex-vivo to induce mitogenesis, enlarge and enrich a tumoricidal T-cell population. Streptococcus pyrogenic exotoxins which have structural and functional homology to the enterotoxins, are also useful in tumoricidal treatment. Chemically derivatized enterotoxins as well as synthetic or genetically prepared polypeptides having structural homology to the native enterotoxins are also useful in this application.

Abstract: A method for reversing expression of malignant phenotype in cancer cells is described. The method comprises applying .beta..sub.1 integrin function-blocking antibody to the cells. The method can be used to assess the progress of cancer therapy. Human breast epithelial cells were shown to be particularly responsive.

Abstract: An antagonist to, or an antibody (Ab) raised against, cpn10 or a recombinant cpn10 with the sequence: GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD is claimed. Also, claimed are: (1) an antagonist or Ab raised against a peptide derived from cpn10, or a peptide with the sequence: Ac-AGQAFRKLPL(C) AGQAFRKFLPLA2 A1AGQAFRKFLPL Ac-A1AGQAFRKFLPL (A1)EKSQGKVLQATA2 A1EKSQGKVLQAT where A1 and A2 are amino acid sequences that may be added to one or both ends of the peptides, and where the peptides may have a single amino acid deletion, addition or substitution; (2) suppressing cellular growth or enhancing immunological activity by admin. of a cpn10 antagonist or anti-cpn10 Ab to a subject; and (3) an assay for measuring anti-cpn10 Ab in a sample by: (a) reacting purified cpn10 with the sample (b) determining the amt. of Ab in the sample by determining the binding between the Ab and cpn10.

Abstract: Metal binding polypeptides which include an amino acid sequence coding for a light chain variable region of a monoclonal antibody capable of immunoreacting with a lead cation and nucleotides which include a nucleic acid sequence coding for the variable region are provided. The invention is also directed to fusion proteins and Fab fragments which include the light chain variable region.

Abstract: A set of contiguous and partially overlapping RNA sequences and polypeptides encoded thereby, designated as PS112 and transcribed from prostate tissue is described. A fully sequenced clone representing a continuous sequence of PS112 is also disclosed. These sequences are useful for the detecting, diagnosing, staging, monitoring, prognosticating, preventing or treating, or determining the predisposition of an individual to diseases and conditions of the prostate, such as prostate cancer. Also provided are antibodies which specifically bind to PS112-encoded polypeptide or protein, and agonists or inhibitors which prevent action of the tissue-specific PS112 polypeptide, which molecules are useful for the therapeutic treatment of prostate diseases, tumors or metastases.

Abstract: Compositions comprising anti-CD45RB antibodies are provided for the prevention or reversal of transplant rejection as well as therapy for autoimmune diseases.

Abstract: Disclosed are various compositions and methods for use in achieving specific blood coagulation. This is exemplified by the specific in vivo coagulation of tumor vasculature, causing tumor regression, through the site-specific delivery of a coagulant using a bispecific antibody.

Abstract: The present invention discloses an effect enhancer for antitumor agents, examples of which include platinum compounds such as cisplatin and carboplatin, and mitomycin C, that contains interleukin-6 (IL-6) antagonist, examples of which include antibody to IL-6, antibody to IL-6 receptor, and antibody to gp130 protein.

Abstract: A drug for prevention and therapy of diseases caused by fibrinoid formation or thrombus formation, as well as a model animal of fibrinoid formation or thrombus formation in the lung is disclosed. The drug for preventing and treating diseases caused by fibrinoid formation or thrombus formation in the lung according to the present invention comprises an inhibitor of interleukin 6 as an effective ingredient. The model animal of the diseases caused by fibrinoid formation or thrombus formation in the lung is a rat in which fibrinoid formation or thrombus formation actually occurs by induction with interleukin 6.

Abstract: Methods are provided for eluting peptides that are bound to major histocompatibility complex ("MHC") molecules expressed on the cell surfaces of viable cells that have at least one MHC-peptide complex on the surfaces of the cells. Methods are provided for using such acid-eluted T cell epitopes, preferably obtained from a patient's tumor, and autologous dendritic cells as the basis for antitumor vaccines.

Abstract: Disclosed are novel autoantigens and methods useful in the detection of autoantibodies in persons that have developed, or are at risk of developing, autoimmune hypoparathyroidism. The novel autoantigens of the subject invention may be used to achieve early diagnosis and treatmcnt of autoimmune hypoparathyroidism, and possibly other autoimmune diseases which arc frequently associated with autoimmune hypoparathyroidism.

Abstract: The present invention relates to a novel hybridoma cell line which secretes monoclonal antibodies capable of binding to the AT.sub.1 subtype of the Angiotensin II receptor. It also relates to monoclonal antibodies secreted by the hybridoma, which antibodies may be used in diagnostic test kits as well as having therapeutic applications.

Abstract: The invention is directed to inter alia two related but self-sufficient improvements in conventional display methods. The first improvement provides methods of enriching conventional display libraries for members displaying more than one copy of a polypeptide prior to affinity screening of such libraries with a target of interest. These methods can achieve diverse populations in which the vast majority of members retaining full-length coding sequences encode polypeptides having specific affinity for the target. In a second aspect, the invention provides methods of subcloning nucleic acids encoding displayed polypeptides of enriched libraries from a display vector to an expression vector without the need for clonal isolation of individual members. These methods result in polyclonal libraries of antibodies and other polypeptides for use, e.g., as diagnostic or therapeutic reagents.

Abstract: Novel compositions are provided that are derived from antigen-binding sites of immunoglobulins having affinity for cancer antigens. The compositions exhibit immunological binding properties of antibody molecules capable of binding specifically to a human tumor cell expressing an antigen selected from the group consisting of high molecular weight mucins bound by 2G3 and 369F10, c-erbB-2 tumor antigen, an approximately 42 kD glycoprotein, an approximately 55 kD glycoprotein, and the approximately 40, 60, 100 and 200 kD antigens bound by 113F1. A number of synthetic molecules are provided that include CDR and FR regions derived from same or different immunoglobulin moieties. Also provided are single chain polypeptides wherein V.sub.H and V.sub.L domains are attached by a single polypeptide linker. The sFv molecules can include ancillary polypeptide moieties which can be bioactive, or which provide a site of attachment for other useful moieties.

Abstract: Methods of modulating pulmonary surfactant secretion and treating conditions such as respiratory distress syndrome, are provided. Compositions for delivering imaging and therapeutic agents through use of the monoclonal antibodies A2C and A2R or fragments thereof are provided. Methods for delivering selected effector molecules such as imaging, modulating and therapeutic agents through use of these compositions are also provided.

Abstract: Methods for the biochemical and immunohistochemical detection of cell apoptosis are described. The methods utilize the detection and measurement of polypeptide fragments generated during apoptosis. Conditions associated with apoptosis may be detected by the methods of this invention. Methods are also presented for the screening of potential therapeutic compounds which inhibit or stimulate apoptosis. Kits for detection of apoptosis and diagnosis of diseases are also provided.

Abstract: Disclosed is a family of vaccines that contain stress protein-peptide complexes which when administered to a mammal are operative to initiate in the mammal a cytotoxic T cell response against cells infected with a preselected intracellular pathogen. Also disclosed are methodologies for preparing and administering vaccines containing such stress protein-peptide complexes.

Abstract: The identification and sequencing of the BRCA2 gene is disclosed as well as the amino acid sequence of the corresponding BRCA2 polypeptides. BRCA2 alleles including those with mutations in the BRCA2 gene which are associated with a predisposition to develop cancer, especially breast and ovarian cancer are also disclosed. The present invention further relates to polypeptides encoded by the above nucleic acid. The present invention further relates to uses of much BRCA2 nucleic acid and BRCA2 polypeptides, in particular in the diagnostic, prognostic or therapeutic treatment of cancer.

Abstract: The invention provides a human fatty acid synthase-like protein (HFASLP) and polynucleotides which identify and encode HFASLP. The invention also provides expression vectors, host cells, antibodies, agonists, and antagonists. The invention also provides methods for treating or preventing disorders associated with expression of HFASLP.

Abstract: A method for treating a primary central nervous system lymphoma in an individual relates to administering intrathecally or intralesionally a therapeutically effective amount of a Fas-cross-linking composition thereby inducing the lymphoma cells to undergo Fas-mediated cytotoxicity. The Fas-cross-linking composition may be an agonist anti-human Fas monoclonal antibody or fragments thereof, soluble Fas-ligand (Fas-L), and a combination thereof. In another embodiment, the lymphoma is pretreated with a composition that enhances Fas-mediated cytotoxicity induced by a Fas-cross-linking composition, followed by treatment with the Fas-cross-linking composition.