Abstract: Methods for the production of immunogenic compositions containing a non-natural amino acid are disclosed. The non-natural amino acid can be a site for attachment of antigens, such as bacterial capsular polysaccharides, to make immunogenic conjugates. Bio-orthogonal attachment chemistry incorporated into the non-natural amino acids allows for more efficient and potent antigen presentation to the immune system, simplified purification, and more well-defined structure of these semi-synthetic immunogens.

Abstract: The present invention relates to compositions of peptide inhibitors of the interleukin-23 receptor (IL-23R) or pharmaceutically acceptable salt or solvate forms thereof, corresponding pharmaceutical compositions, methods and/or uses for treatment of autoimmune inflammation and related diseases and disorders.

Abstract: The invention provides an isolated peptide containing a motif that binds antiphospholipid antibodies (aPLA) and that is recognized by CD4+ T cells that are able to induce production of antiphospholipid antibodies (aPLA). The present invention further provides methods for detection of aPLA and CD4+ T cells able to induce production of aPLA. The present invention also provides methods for treating the antiphospholipid syndrome (APS).

Abstract: The present invention relates to polypeptides which are covalently bound to molecular scaffolds such that two or more peptide loops are subtended between attachment points to the scaffold. In particular, the invention describes peptides which bind to TREM2. The invention also relates to multimeric binding complexes which comprise at least two of said bicyclic peptide ligands. The invention also includes pharmaceutical compositions comprising said peptide ligands and multimeric binding complexes and the use of said peptide ligands, multimeric binding complexes and pharmaceutical compositions in preventing, suppressing or treating a disease or disorder mediated by TREM2.

Abstract: Methods of preparing protein films in the presence of organofluorine compounds are provided that can produce protein films that retain the solution phase characteristics of the proteins. The protein films can be coatings for medical devices.

Abstract: A cell penetrating peptide (CPP) according to the present invention is a novel cationic cell penetrating peptide that can effectively transport a biologically active molecule by passing through a cell membrane even when a biologically active molecule is bound thereto, and compared with conventional CPPs, it has excellent cell permeability enabling the transport of a biologically active molecule into cells, and the delivered biologically active molecule may effectively maintain its activity in cells. Accordingly, the CPP of the present invention may be very useful in various fields including cosmetics, diagnostics, drug delivery systems, recombinant protein vaccines, DNA/RNA therapeutics, and gene and protein therapy.

Abstract: The present application provides stable peptide-based IDO1 capture agents and methods of use as detection, imaging, diagnostic and therapeutic agents. The application further provides methods of manufacturing IDO1 imaging agents.

Abstract: Disclosed is a polypeptide having a phase transition behavior, wherein the polypeptide consists of a Val-Pro-Gly-Xaa-Gly pentapeptide repeat or a Val-Pro-Ala-Xaa-Gly) pentapeptide repeat, and the polypeptide includes a [Val-Pro-Gly-Xaa-Gly]n or a [Val-Pro-Ala-Xaa-Gly]n (SEQ ID NO:2) pentapeptide repeat. In addition, the present invention provides a multi-stimuli polypeptide composed of polypeptide-calmodulin-polypeptide having a phase transition behavior and a hydrogel prepared using the same. A dynamic protein hydrogel according to the present invention may be used as a drug carrier, as a scaffold for tissue engineering or as a kit for tissue or organ regeneration.

Abstract: Disclosed herein are novel synthetic polypeptides and uses thereof in the preparation of liposomes. According to embodiments of the present disclosure, the synthetic polypeptide comprises a membrane lytic motif, a masking motif, and a linker configured to link the membrane lytic motif and the masking motif. The linker is cleavable by a stimulus, such as, light, protease, or phosphatase. Once being coupled to a liposome, the exposure to the stimulus cleaves the linker that results in the separation of the masking motif from the membrane lytic motif, which in turn exerts membrane lytic activity on the liposome that leads to the collapse of the intact structure of the liposome, and releases the agent encapsulated in the liposome to the target site. Also disclosed herein are methods of diagnosing or treating a disease in a subject by use of the present liposomes.

Abstract: Methods for regulating multiple organs, multiple genes and multiple targets by using a polypeptide. The polypeptide includes the amino acid sequence of SEQ ID No. 1 and/or homology thereof. The polypeptide reveals the potency to regulate transcription of multiple genes and expression of multiple targets. Therefore, a composition having the polypeptide can be applied to regulate the expression of multiple targets in multiple organs of patients. Furthermore, the composition having the polypeptide can be applied in therapies of inflammation and inflammatory disorders, suppression of fatty liver disease progression, suppression of the diseases caused by fatty accumulation, prevention and therapy of muscular atrophy, and avoiding the complications of diabetes.

Abstract: Disclosed herein are GDF11 variant polypeptides. Also disclosed herein are methods for increasing GDF11 protein levels in a subject by administering a GDF11 variant polypeptide.

Abstract: The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.

Abstract: Engineered, non-naturally occurring antimicrobial NCR13 variant peptides (NVPs), or agriculturally acceptable salts thereof, are described, along with methods of making and using the same. The present disclosure is also related to and describes novel antimicrobial compositions, formulations, and methods of using the same, that are useful for the control of pathogenic microbes.

Abstract: The present disclosure provides activatable and detectable membrane-interacting peptides that, following activation, can interact with phospholipid bilayers, such as cell membranes. The present disclosure also provides methods of use of such compounds. The compounds of the present disclosure are of the general structure X1a-A-X2—Z—X1b, where A is a membrane-interacting peptide region having a plurality of nonpolar hydrophobic amino acid residues that, following separation from portions Z, is capable of interaction with a phospholipid bilayer; Z is an inhibitory peptide region that can inhibit the activity of portion A; X2 is a cleavable linker that can be cleaved to release cleavage products from the compound; and X1a and X1b are optionally-present chemical handles that facilitate conjugation of various cargo moieties to the compound. Prior to cleavage of the composition at X2, the composition acts as a promolecule that does not associate with cellular membranes to a significant or detectable level.

Abstract: An oligopeptide with anti-inflammatory activity, a preparation method, and an application thereof are provided, belonging to the field of biotechnology. An amino acid sequence of the oligopeptide is shown as SEQ ID NO:1. The preparation method includes: digesting a wheat germ protein through a simulated gastrointestinal tract to obtain protein digestion products; separating the protein digestion products by ultrafiltration membranes to obtain components I (>3 kDa), II (1˜3 kDa), and III (<1 kDa), screening the components to obtain III as an anti-inflammatory active component, and finally identifying the oligopeptide by LC-MS/MS polypeptide. The oligopeptide has strong anti-inflammatory activity, is derived from the wheat germ protein, has the characteristics of safety, high efficiency, simple preparation method, good repeatability, has broad prospects in food, medicine, and other fields, and can be applied to preparations of medicines or functional foods for preventing and treating enteritis.

Abstract: Long-acting agonistic analogs for CLR/RAMP receptors are provided that have an extended half-live in vivo.

Abstract: The present invention is generally directed to chemically synthesized peptides that are charged with zinc ions (herein “zinc-charged peptides”). The chemically synthesized peptides are based on the amino acid sequence of alpha-lactalbumin. The present invention is further directed to a method of preparing these two zinc-charged peptides by charging the chemically synthesized peptides with zinc ions. It is observed that charging these peptides with zinc ions activate the peptide's ability to induce apoptosis in cancer cell lines, as well as increase ATP, reduce Tau protein and inhibit P38 in the brain. The zinc-charged peptides are thus capable of treating cancer and diseases involving tauopathy such as Alzheimer's Disease. The present invention is thus further directed to a method of treating cancer and diseases involving tauopathy such as Alzheimer's Disease using the zinc-charged peptides.

Abstract: The present invention relates to effective pain therapies in companion animals. In particular, an isolated companion animal p75NTR protein or a fusion protein containing the same or portions thereof are contemplated. Nucleic acids encoding the proteins are also encompassed in the invention as well as methods of using the same.

Abstract: Polypeptides derived from fibronectin are presented that are neutrophil elastase-resistant and can bind to growth factors and/or enhance growth factor activity. These polypeptides are useful for enhancing wound healing in a patient.

Abstract: A glucagon-like peptide-2 (GLP-2) derivative, a conjugate thereof, and a use thereof are disclosed. Additionally, a method for preparing a glucagon-like peptide-2 (GLP-2) derivative and a conjugate thereof is disclosed.