Abstract: Therapeutic effectiveness of antigen doses is improved by an adjuvant comprised of a mixture of lecithin in combination with a carrier which may be selected from the group consisting of non-edible oils such as mineral oil and edible triglyceride oils such as soybean oil.

Abstract: The present disclosure is directed to improved pharmaceutical compositions employing inteferon-gamma which have been treated to remove interferon-gamma inhibitory activity associated with such preparations. In addition, the present disclosure details treatment protocols, including the elevation of patient body temperature and the use of combined or sequential interferon-gamma treatments, to enhance inteferon-gamma efficacy and reduce the resistance associated with inteferon-alpha and/or beta therapy.

Abstract: A method for attachment of glycocompounds and glycoconjugates to hydrazide gels, wherein a solution of glycocompound or glycoconjugate containing a suitable oxidizing agent is brought into contact with the hydrazide gel without prior removal of the oxidizing agent. Suitably, the solution is introduced into a cartridge containing the hydrazide gel. In accordance with a first embodiment, this method requires relatively short incubations of about 30 minutes for oxidation of the glycosaccharide moiety of the glycocompound or glycoconjugate, followed by about 15 minutes for binding the oxidized glycocompound or glycoconjugate to the hydrazide gel. Pursuant to another embodiment, incubation with the oxidizing agent is carried out simultaneously with bringing the solution into contact with the gel (e.g., within the cartridge). Synthetic polymer gels with terminal hydrazide groups are particularly suitable for use in this method, as these gels are especially resistant to oxidizing agents such as sodium periodate.

Abstract: Cyclosporins having anti-bacterial activity useful as immuno suppressive and anti-inflammatory agents are provided, such as undecapeptides of the formula (I) ##STR1## in which A.sub.1 is either derived from 2-carboxyazetidine, 2-carboxypyrrolidine or 2-carboxypiperidine, or is an amino acid residue ##STR2## wherein n is 0, 1 or 2, X represents an amino, methylamino, mercapto or hydroxy group, R represents hydrogen or an acyclic aliphatic hydrocarbon group and R' represents hydrogen or methyl; A.sub.2 is an amino acid residue ##STR3## wherein R.sub.1 is an acyclic aliphatic hydrogen group optionally substituted at the C.sub.1 position of the group R.sub.1 by an amino, methylamino, mercapto or hydroxy group, but with the proviso that when R.sub.1 is a group of less than four carbon atoms then A.sub.1 is a heterocyclic amino acid residue or is an amino acid residue --R'N--CH(CHR(CH.sub.2).sub.

Abstract: A peptide analogue of mammalian insulin-like growth factor-1 wherein from 1 to 5 amino acid residues are absent from the N-terminal.

Abstract: Imidazole compounds including imidazoles and imidazolium salts, and their use as transglutaminase inhibitors are disclosed.

Abstract: Compositions of zwitterionic drugs for transdermal administration and methods of administering zwitterions transdermally are disclosed. The compositions comprise a zwitterionic drug in a salt form and a solvent therefor.

Abstract: A composition for use in inducing binding between parts of mineralized tissue by regeneration of mineralized tissue on at least one of the parts, containing as an active constituent a protein fraction originating from a precursor to dental enamel, so called enamel matrix;a process for inducing binding between parts of living mineralized tissue by regeneration of mineralized tissue on at least one of the parts using such composition.

Abstract: Immunological carrier complexes are provided utilizing the VP6 polypeptide from rotavirus as the carrier molecule. Also provided are methods of binding epitope-bearing molecules (e.g., haptens) to the VP6 carrier molecule through binding peptides. The VP6 carrier can be a VP6 monomer, oligomer, or a particle containing of VP6 oligomers.

Abstract: A unique class of vasopressin analogue antagonists is provided which have the pharmacological property in-vivo to antagonize pressor (V.sub.1) and/or antidiuretic (V.sub.2) activities. The chemical modifications to the vasopressin 9 member chain sequence at the no. 1, 2, and 4 positions yield a class of potent analogue antagonists which may be employed therapeutically to treat hypertension, congestive heart failure, various edematous situations, and a variety of symptoms due to inappropriate vasopressin secretion.

Abstract: 2-Adamantyl- and 1-adamantyl-D/L-glycyl-L-alanyl-D-isoglutamine and their derivatives of the formulae ##STR1## wherein R stands for a hydrogen atom or a MurNAc group, and hydrochlorides thereof,a process for the preparation thereof and their use to obtain pharmaceuticals, which are particularly indicated for the treatment of viral diseases and tumors and/or immunomodulations in humans and animals.

Abstract: Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.

Abstract: Disclosed are novel peptide and pseudopeptide derivatives and phrmaceutical compositions thereof that inhibit platelet aggregation and thrombus formation in mammalian blood.

Abstract: Inhibitors of phospholipase A.sub.2 activity at the cell-surface membrane whose molecular structure comprises a cell-permeable PLA.sub.2 -inhibitor moiety covalently bonded directly or indirectly to a physiologically acceptable carrier moiety which is effective to inhibit cell internalization of the cell-permeable PLA.sub.2 -inhibitor moiety, with the proviso that phosphatidylserine is not bonded indirectly via divalent dodecanedioyl to dextrane hydrazide.

Abstract: A complex of N-acetyl-glucosaminyl-N-acetyl-muramoyl-L-alanyl-D-isoglotaminyl- (L)-meso-diamino-pimelyl-(D-amide)-D-alanyl-D-alanine with bivalent metals chosen from the group comprising Cu.sup.2+, Zn.sup.2+, Co.sub.hu 2+ ; Ni.sup.2+ and Cd.sup.2+ in the molar ratio of the organic ligand: Cu.sup.2+ =2:1 and the organic ligand: Zn.sup.2+ or Co.sup.2+ or Ni.sup.2+ or Cd.sup.2+ =1:1, compositions containing it and their use in the treatment of immunological insufficiencies and disturbances in humans and animals.

Abstract: A method for extracting collagen from animal collagen-containing tissue using a solution of an organic diamine or amino-alcohol salt. The collagen product has many uses such as cell growth matrices, prosthetic devices, synthetic skin, dressings for wounds, or membranes.

Abstract: A synthetic peptide of the formula: H-.sub.D -A.sub.1 -Leu-Lys-NH ##STR1## wherein A.sub.1 is Pro or Ala, is excellent in solubility in water and substrate specificity and is suitable as a substrate for determining trypsin and .alpha..sub.1 -antitrypsin.

Abstract: The invention provides novel compositions for topical application, e.g. for the treatment of psoriasis, comprising finely divided dithranol dispersed in a thickened aqueous medium.

Abstract: Method for increasing milk production in mammals including man, and/or for increasing the birth weight of their newborn and improving postnatal growth, according to which the female mammal is supplied during pregnancy with an effective amount of hGRF or of one of its analogs, or alternatively of an active fragment of hGRF or of one of its analogs.The treatment is of short duration, for example from 10 to 20 days. Its effects are lasting and extend throughout the lactation period.Application to the treatment of animals of ovine, caprine, bovine or porcine species.

Abstract: The invention provides a method and reagent for the modification of polypeptides useful in experimental research in the area of genetic engineering starting from a polypeptide such as hCCK-33 in an unsulfated form which contains Tyr and Ser and/or Thr residues by first protecting the amino-groups in the starting polypeptide, masking the OH-groups in the Ser and/or Thr residues and selectively sulfating the OH-groups in the Tyr residues after deprotection.