Abstract: The technology relates to monoclonal antibodies useful in the identification of cancer cells. In one embodiment, mAbs with specificity for tumor antigens are provided. In one embodiment, methods for treating cancer using mAbs are provided. In another embodiment, methods for detecting cancerous cells are provided. In another embodiment, kits for detecting cancerous cells are provided.

Abstract: The present invention provides: a novel DNA, a carcinoma-associated gene comprising the DNA, a recombinant protein encoded by the DNA, an antibody binding to the protein, an anti-carcinoma agent comprising the antibody, a low-molecular-weight compound binding to the protein, and a screening system. An example of such a novel DNA is a DNA comprising a nucleotide sequence encoding the following polypeptide (a) or (b): (a) a polypeptide, consisting of an amino acid sequence identical to or substantially identical to the amino acid sequence represented by SEQ ID NO: 2; or (b) a polypeptide, consisting of an amino acid sequence derived from the amino acid sequence represented by SEQ ID NO: 2 by deletion, substitution, or addition of one or a plurality of amino acids and having biological activity substantially equivalent to the functions of the polypeptide (a).

Abstract: The invention provides improved agents and methods for treatment of diseases associated with amyloid deposits of A? in the brain of a patient. Preferred agents include humanized antibodies.

Abstract: The invention relates to antibodies or a plurality of antibodies against human bone sialoprotein (BSP), characterized in that the antibodies bind to epitopes which are present only in human bone sialoprotein from tumor cells, the post-translational glycosylation of which is modified or incomplete in the region of amino acids of 120 to 135, containing the amino acids TGLAA (SEQ ID NO: 2), in comparison with normal bone sialoprotein from bones. The antibodies are put to use in an immunoassay for the diagnosis and prognosis of tumor diseases, in particular the diagnosis and prognosis of bone metastases in the case of primary breast carcinoma.

Abstract: Described is a novel gene and its encoded secreted tumor antigen, termed BPC-1, and to diagnostic and therapeutic methods and compositions useful in the management of various cancers which express BPC-1, particularly including prostate cancer and bladder cancer. In human normal tissues, BPC-1 is only expressed in certain tissues of the brain. However, BPC-1 is expressed at high levels in prostate cancer cells and is also expressed in bladder cancer cells. The structure of BPC-1 includes a signal sequence and a CUB domain. BPC-1 protein is secreted. Preliminary experimental evidence suggests that BPC-1 is directly involved in oncogenesis or maintenance of the transformed phenotype of cancer cells expressing BPC-1. BPC-1 also appears to bind specifically to a cellular protein expressed in prostate cancer cells and other cells.

Abstract: This invention relates to isolated peptides derived from MAGE-C2, nucleic acid molecules that encode MAGE-C2 and the isolated peptides derived from MAGE-C2, expression vectors comprising the nucleic acid molecules, host cells transformed or transfected with the nucleic acid molecules or the expression vectors, and to tetramers comprising the peptides, HLA molecules, ?2 microglobulin and a first and second binding partner. This invention also relates to methods for using the peptides, nucleic acid molecules, expression vectors, tetramers and complexes of this invention as well as to cytolytic T cells which recognize the peptides in complex with an HLA molecule.

Abstract: The invention relates to the identification of gene products that are the result of tumor-associated expression and the nucleic acids encoding the same. The invention also relates to the therapy and diagnosis of diseases wherein these gene products are the result of an aberrant tumor-associated expression. The invention also relates to the proteins, polypeptides and peptides that are the result of tumor-associated expression and to the nucleic acids encoding the same.

Abstract: The present invention is based on the discovery that the cytoxicity of anti-desmocollin 2 (DSC2) antibodies can be used for treating various cancers including lung, colon, pancreatic, prostate, breast, gastric or liver cancers. Specifically, the present invention provides antibodies against DSC2 that have effector function. Furthermore, the present invention provides methods and pharmaceutical compositions that comprise anti-DSC2 antibody as an active ingredient for damaging DSC2-expressing cells via the effector function of the antibody.

Abstract: The invention provides polypeptides comprising a variant heavy chain variable framework domain (VFR). In some embodiments, the amino acids defining the VFR form a loop of an antigen binding pocket. In an embodiment, the polypeptide is a variable domain of a monobody and has a variant VFR. The polypeptide may optionally comprise one or more complementary determining regions (CDRs) of antibody variable domains. In an embodiment, the polypeptide is a variable domain of a monobody and has a variant VFR and one or more variant CDRs. Libraries of polypeptides that include a plurality of different antibody variable domains generated by creating diversity in a VFR, and optionally, one or more CDRs are provided and may be used as a source for identifying novel antigen binding polypeptides that can be used therapeutically or as reagents. The invention also provides fusion polypeptides, compositions, and methods for generating and using the polypeptides and libraries.

Abstract: Polynucleotides and polypeptides which participate in influenza virus infection of cells and nucleic acid molecules, which include a polynucleotide sequence capable of specifically binding the polypeptides of the present invention. Also provided are methods of using such nucleic acid molecules, polynucleotides and antibodies directed thereagainst for diagnosing, treating and preventing influenza virus infection.

Abstract: Compositions and methods for the treatment of cancer, particularly melanoma, myeloma, small cell lung cancer, thymic lymphoma, T-cell lymphoma, B-cell lymphoma, osteosarcoma, and acute T-cell leukemia, are disclosed. Illustrative compositions include one or more anti-ganglioside antibodies and polynucleotides that encode such anti-ganglioside antibodies. These antibodies may be for example, hamster antibodies, chimeric human/hamster antibodies, or humanized antibodies. The disclosed compositions are useful, for example, in the treatment of cancer and can be used to induce apoptosis in a cancer cell.

Abstract: The invention methods using a insulin-like growth factor receptor inhibitor to inhibit tumor cell growth in a subject in need thereof.

Abstract: The present invention relates to a combination of peptides that may be used for treatment of cancer. The peptide combination competes for the binding of specific neuropeptides at the plasma membrane and thereby alters the levels of key intracellular molecules implicated in cell proliferation, resulting in a broad spectrum of anticancer activity. The invention also relates to pharmaceutical compositions containing a combination of such peptide analogs.

Abstract: The present invention provides CDR-grated antibodies against human tissue factor that retain the high binding affinity of rodent monoclonal antibodies against tissue factor but have reduced immunogenicity. The present humanized antibodies are potent anticoagulants and are thus useful in the treatment and prophylaxis of human thrombotic disease. The invention also provides methods of making the CFR-grafted antibodies and pharmaceutical compositions for the attenuation or prevention of coagulation.

Abstract: Recombinant immunotoxins are fusion proteins composed of the Fv domains of antibodies fused to bacterial or plant toxins. RFB4 (Fv)-PE38 is an immunotoxin that targets CD22 expressed on B cells and B cell malignancies. The present invention provides antibodies and antibody fragments that have improved ability to bind the CD22 antigen of B cells and B cell malignancies compared to RFB4. Immunotoxins made with the antibodies and antibody fragments of the invention have improved cytotoxicity to CD22-expressing cancer cells. Compositions that incorporate these antibodies into chimeric immunotoxin molecules that can be used in medicaments and methods for inhibiting the growth and proliferation of leukemia and lymphoma cells.

Abstract: The present invention provides binding molecules that specifically bind to ILT3, e.g., human ILT3 (hILT3), on antigen presenting cells, such as for example, monocytes, macrophages and dendritic cells (DC), e.g., monocyte-derived dendritic cells (MDDC). The binding molecules of the invention are characterized by binding to hILT3 with high affinity and downmodulating immune responses in vitro, e.g., downmodulating alloimmune responses; the production of inflammatory cytokines by dendritic cells, e.g., monocyte-derived dendritic cells (MDDC); the upregulation of costimulatory molecules by DC, e.g., MDDC; and/or calcium flux in monocytes. In addition, the binding molecules upregulate the expression of inhibitory receptors on dendritic cells, e.g., immature dendritic cells. Surprisingly, these same binding molecules which downmodulate immune responses in vitro, are immunostimulatory in vivo. Various aspects of the invention relate to binding molecules, and pharmaceutical compositions thereof.

Abstract: The invention features methods of evaluating the risk of cancer recurrence in a subject diagnosed with cancer.

Abstract: The present invention relates to a novel protein designated 20P2H8 which shares homology with several heterogeneous nuclear ribonucleoproteins (hnRNPs). A full length approximately 3600 bp 20P2H8 cDNA (SEQ ID NO: 1, encoding a 517 amino acid open reading frame (SEQ ID NO: 2), is provided herein.

Abstract: Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53.

Abstract: The present invention is directed to compositions of matter useful for the diagnosis and treatment of tumor in mammals and to methods of using those compositions of matter for the same.