Patents Examined by Paula K. Hutzell
-
Patent number: 6177613Abstract: The present invention provides a composition and method for regulating expression of heterologous nucleotide sequences in a plant. The composition is a novel nucleic acid sequence for a seed-preferred promoter. A method for expressing a heterologous nucleotide sequence in a plant using the promoter sequence is also provided. The method comprises transforming a plant cell to contain a heterologous nucleotide sequence operably linked to the seed-preferred promoter of the present invention and regenerating a stably transformed plant from the transformed plant cell.Type: GrantFiled: January 8, 1999Date of Patent: January 23, 2001Assignee: Pioneer Hi-Bred International, Inc.Inventors: Sean J. Coughlan, Ronnie J. Winfrey, Jr.
-
Patent number: 6175059Abstract: This invention describes a novel means of introducing foreign genes and/or viruses, wildtype or recombinant, into plant cells via a seed treatment method using recombinant or wildtype furoviruses and their natural fungal vectors. Because of its ease of application, longevity of the seed treatment product, minimal risk of transmission to subsequent seed generations, specificity, and universality within a species, it offers a significant improvement over prior art techniques for viral mediated gene delivery techniques. The unique and critical aspect of the invention is the use of seed treatment technology for delivering foreign genes or viruses into plants for, for example, the enhancement of agronomic traits and production of desirable products such as pharmaceuticals.Type: GrantFiled: March 21, 1997Date of Patent: January 16, 2001Assignee: Texas A & M UniversityInventor: Charles M. Rush
-
Patent number: 6169233Abstract: An inbred maize line, designated NP2031, the plants and seeds of inbred maize line NP2031, methods for producing a maize plant produced by crossing the inbred line NP2031 with itself or with another maize plant, and hybrid maize seeds and plants produced by crossing the inbred line NP2031 with another maize line or plant.Type: GrantFiled: January 29, 1999Date of Patent: January 2, 2001Assignee: Novartis AGInventor: David Wesley Mies
-
Patent number: 6169232Abstract: The invention disclosed herein provides genes and methods of creating and using said genes for expression in the seed of a plant like corn. When the genes are expressed endogenously, the result in the production of proteins that increase the nutritional value of the feed made from said seed. Also disclosed is a method of designing genes for use in production of proteins that can be expressed in a manner whereby the nutritional value of feed can be increased.Type: GrantFiled: June 16, 1998Date of Patent: January 2, 2001Assignee: Dow AgroSciences LLCInventors: Timothy D. Hey, Ann Owens Merlo, Terence A. Walsh
-
Patent number: 6159701Abstract: Methods of treating and/or imaging tumors utilize A.sub.1 adenosine-receptor activated cells (such as monocytes and macrophages) are described. Activated cells may be administered systemically or locally, and may be radiolabelled to provide imaging and diagnostic functions. Macrophages resident in tissues may be primed and activated for use in treating and imaging tumors.Type: GrantFiled: November 8, 1996Date of Patent: December 12, 2000Assignee: Link Technology IncorporatedInventor: Constance Neely
-
Patent number: 6153189Abstract: The invention concerns human trkB and trkC receptors and their functional derivatives. The invention further concerns immunoadhesins comprising trk receptor sequences fused to immunoglobulin sequences.Type: GrantFiled: September 18, 1998Date of Patent: November 28, 2000Assignee: Genentech, Inc.Inventors: Leonard G. Presta, David L. Shelton, Roman Ufer
-
Patent number: 6150500Abstract: The regulatory peptides for constitutive nitric oxide synthase enzymes, and a peptide specific to inducible nitric oxide synthase, as well as derivatives of the peptides, homologous peptides, nucleic acids encoding the peptides, derivatives, and homologous peptides, and antibodies to the peptides, derivatives, and homologous peptides, are disclosed. The peptides, derivatives, homologous peptides, antibodies, and nucleic acids, as well as peptidomimetics, can be used in methods of modulating the activity of nitric oxide synthase enzymes, and also in methods of treating diseases or conditions modulated by production of nitric oxide by nitric oxide synthases. Assays for identifying agents which modulate the activity of the nitric oxide synthase enzymes are also described.Type: GrantFiled: July 12, 1996Date of Patent: November 21, 2000Inventor: John C. Salerno
-
Patent number: 6130085Abstract: A recombinant vector for cloning a heterologous nucleotide sequence and/or expressing it and/or transferring it to a cell host. The vector includes, at a site which is not essential for replication, the gene coding for a lipoprotein other than E. coli lipoproteins, or a part of said gene which contains the elements required for controlling the expression of said lipoprotein and exposing it on the surface of the outer host cell membrane, so that the heterologous nucleotide sequence can be inserted into the gene or said part thereof under conditions suitable for expressing said heterologous sequence and exposing it on the surface of the cell host.Type: GrantFiled: April 8, 1996Date of Patent: October 10, 2000Inventors: Raymond Hamers, Pierre Cornelis
-
Patent number: 6129914Abstract: The invention provides bispecific antibodies with selective cytotoxicity against malignant B-cells. The bispecific antibodies bind to an effector cell antigen and to a 28/32 kDa heterodimeric protein on the surface of malignant B-cells. The invention also includes the monospecific components of the bispecific antibodies, humanized versions thereof, and humanized bispecific antibodies. The invention further provides therapeutic and diagnostic methods employing these antibodies.Type: GrantFiled: March 1, 1995Date of Patent: October 10, 2000Assignee: Protein Design Labs, Inc.Inventors: George Weiner, Roger Gingrich, Brian K. Link, J. Yun Tso
-
Patent number: 6123915Abstract: A therapeutic method of modulating the immune response, by administering to a patient an amount of IL-4 effective to promote peripheral blood lymphocyte adhesion to microvascular endothelial cells in lymphoid organs. The IL-4 is preferably coadministered with IL-1.beta..An improved method of screening a cell line for the production of a binding partner that binds with a cell adhesion molecule, by contacting the binding partner with IL4-activated and nonactivated microvascular endothelial cells, and selecting binding partners that bind to the IL4-activated microvascular endothelial cells but not to the nonactivated microvascular endothelial cells. The selected binding partners may thereafter be tested for the ability to block lymphocyte binding to cytokine-activated endothelial cells. The binding partners are preferably also characterized by binding to human VCAM-1 and to IL4- or TNF.alpha.-activated bone marrow stromal cells. A representative embodiment is mAb 6G10 produced by hybridoma ATTC No. HB 10519.Type: GrantFiled: June 7, 1995Date of Patent: September 26, 2000Assignee: Fred Hutchinson Cancer Research CenterInventors: Boris Masinovsky, William Michael Gallatin, Paul J. Simmons
-
Patent number: 6124436Abstract: Cell surface antigens from mammals, reagents related thereto, including purified proteins, specific antibodies, and nucleic acids encoding said antigens. Methods of using said reagents and diagnostic kits are also provided.Type: GrantFiled: February 13, 1996Date of Patent: September 26, 2000Assignee: Schering CorporationInventors: Terrill K. McClanahan, Daniel M. Gorman, Laurel M. Bolin
-
Patent number: 6121232Abstract: A stabilized solution of fibrinogen containing samples, in particular a stabilized solution of the biological active component (BAC) which is a solution of proteins derived from blood plasma comprising fibrinogen, tranexamic acid and arginine or lysine or mixtures or arginine and lysine, their pharmaceutically acceptable salts, as well as, optionally, substances forming a buffered solution in aqueous medium.Type: GrantFiled: February 10, 1997Date of Patent: September 19, 2000Assignee: Omrix Biopharmaceuticals SAInventors: Israel Nur, Lilliana Bar, Oded Lieberman
-
Patent number: 6121015Abstract: A gene, flanking 5' and 3' sequences and derived cDNA encoding a rat D.sub.4 dopamine receptor that is predominantly located in the cardiovascular and retinal systems is disclosed. The cDNA has been expressed in transfected mammalian cells and demonstrated to preferentially bind dopamine antagonists such as clozapine. The cDNA is useful as a probe for related D.sub.4 dopamine receptors. Expressed in appropriate cell lines, it is useful as an in vitro screen for drugs which specifically bind to the receptor. Drugs that specifically bind to the receptor are then screened using standard methodology in rats, mice or dogs, for the physiological effects. Amino acids deduced from the determination of cDNA can be used to generate either polyclonal or monoclonal antibodies which recognize the D.sub.4 receptor sequence but do not recognize D.sub.1, D.sub.2, D.sub.3 or D.sub.5 dopamenergic receptors, for use in immunocytochemical studies, and for identification and isolation via flow sorting of D4 expressing cell types.Type: GrantFiled: June 7, 1995Date of Patent: September 19, 2000Assignee: Washington UniversityInventors: Karen L. O'Malley, Richard D. Todd
-
Patent number: 6121037Abstract: The present invention relates to novel bacterial hemoglobin receptor proteins and genes that encode such proteins. The invention is directed toward the isolation, characterization, diagnostic and therapeutic use of bacterial hemoglobin receptor proteins, nucleic acid encoding such proteins, recombinant expression constructs comprising such nucleic acids and cells transformed therewith, and antibodies and epitopes of such hemoglobin receptor proteins. The invention relates particularly to hemoglobin receptor proteins and genes encoding such proteins from Neisseria species, especially N. meningitidis and serotypes thereof, and N. gonorrhoeae. Methods for the diagnostic and therapeutic use of the proteins, epitopes, antibodies and nucleic acids of the invention are also provided, including the use of the proteins, epitopes, antibodies and nucleic acids of the invention for the production of vaccines effective in providing immunization of a human against infection by pathogenic bacteria of Neisseria species.Type: GrantFiled: October 2, 1995Date of Patent: September 19, 2000Inventors: Igor Stojiljkovic, Magdalene So, Vivian Hwa, Fred Heffron, Xavier Nassif
-
Patent number: 6113899Abstract: An antagonist to, or an antibody (Ab) raised against, cpn10 or a recombinant cpn10 with the sequence: GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD is claimed. Also, claimed are: (1) an antagonist or Ab raised against a peptide derived from cpn10, or a peptide with the sequence: Ac-AGQAFRKLPL(C) AGQAFRKFLPLA2 A1AGQAFRKFLPL Ac-A1AGQAFRKFLPL (A1)EKSQGKVLQATA2 A1EKSQGKVLQAT where A1 and A2 are amino acid sequences that may be added to one or both ends of the peptides, and where the peptides may have a single amino acid deletion, addition or substitution; (2) suppressing cellular growth or enhancing immunological activity by admin. of a cpn10 antagonist or anti-cpn10 Ab to a subject; and (3) an assay for measuring anti-cpn10 Ab in a sample by: (a) reacting purified cpn10 with the sample (b) determining the amt. of Ab in the sample by determining the binding between the Ab and cpn10.Type: GrantFiled: May 29, 1996Date of Patent: September 5, 2000Assignee: The University of QueenslandInventors: Halle Morton, Alice Christina Cavanagh
-
Patent number: 6111079Abstract: Metal binding polypeptides which include an amino acid sequence coding for a light chain variable region of a monoclonal antibody capable of immunoreacting with a lead cation and nucleotides which include a nucleic acid sequence coding for the variable region are provided. The invention is also directed to fusion proteins and Fab fragments which include the light chain variable region.Type: GrantFiled: December 4, 1996Date of Patent: August 29, 2000Assignee: Bionebraska, Inc.Inventors: Dwane E. Wylie, Osvaldo Lopez, Peter Joseph Murray, Peter Goebel
-
Patent number: 6110739Abstract: The present invention relates to novel immortalized precursor cell populations derived from embryonic stem cell populations and methods to produce such cell populations. Also disclosed is an assay to identify regulatory compounds capable of controlling cell growth for therapeutic and experimental use.Type: GrantFiled: February 22, 1999Date of Patent: August 29, 2000Assignee: National Jewish Medical and Research CenterInventors: Gordon M. Keller, Robert G. Hawley, Kyunghee Choi
-
Patent number: 6107271Abstract: Compositions and methods are described for the specific identification of NMDA receptors, and for the specific identification and manipulation of NMDA glycine co-agonist biological activity.Type: GrantFiled: June 8, 1998Date of Patent: August 22, 2000Assignee: NYXIS Neuro Therapies, Inc.Inventors: Joseph R. Moskal, Hirotaka Yamamoto, Patricia A. Colley
-
Patent number: 6107103Abstract: PSP94 occurs in the serum mainly as a complex with carrier protein. Determination of bound PSP94 provides an indicator of prognosis in prostate cancer and assists in diagnosis of prostate cancer in patients with borderline elevations of PSA.Type: GrantFiled: October 14, 1997Date of Patent: August 22, 2000Assignee: Procyon Bropharma Inc.Inventors: Jian W. Xuan, Joseph L. Chin
-
Patent number: 6103232Abstract: The present invention relates to methods of inducing neurite outgrowth in the central nervous system by antagonizing neural growth inhibitory factors. More particularly, the present invention is directed to use of antibodies to the central nervous system (CNS) myelin associated proteins; such antibodies can be used in the diagnosis and therapies of nerve damage resulting from trauma, infarction, and degenerative disorders of the CNS. In a specific embodiment of the invention, the monoclonal antibody IN-1 may be used to promote neurite outgrowth of nerve fibers over long distances in spinal cord lesions.Type: GrantFiled: June 5, 1995Date of Patent: August 15, 2000Assignee: Erziehungsdirektion of the Canton ZurichInventors: Martin E. Schwab, Pierenrico W. Caroni, Paolo A. Paganetti