Patents Examined by Rebecca E. Prouty
  • Method for detecting using ?-glucosidase activity
    Patent number: 7588909
    Abstract: The present invention concerns a method for specifically detecting and identifying Streptococcus agalactiae, using a reaction medium comprising at least one ?-glucosidase enzymatic substrate.
    Type: Grant
    Filed: September 14, 2005
    Date of Patent: September 15, 2009
    Assignee: Biomerieux
    Inventor: Denis Robichon
  • Compositions and methods for fusion protein separation
    Patent number: 7585943
    Abstract: The present invention relates to compositions and methods for fusion protein separation utilizing a peptide linker comprising a novel thrombin cleavage site.
    Type: Grant
    Filed: April 20, 2006
    Date of Patent: September 8, 2009
    Assignee: ViroMed Co., Ltd.
    Inventors: Sujeong Kim, Jong-Mook Kim, Song Shan Xu
  • Methods to produce lung surfactant formulations via lyophilization and formulations and uses thereof
    Patent number: 7582312
    Abstract: Methods of producing lung surfactant formulations through solvent dissolution and lyophilization are described as well as surfactant formulations derived therefrom. Methods of treating respiratory distress dysfunction are also provided.
    Type: Grant
    Filed: November 14, 2005
    Date of Patent: September 1, 2009
    Assignee: Discovery Laboratories, Inc.
    Inventors: Mark Johnson, Roy Coe
  • Nucleic acid and amino acid sequences relating to for diagnostics and therapeutics
    Patent number: 7582449
    Abstract: The invention provides isolated polypeptide and nucleic acid sequences derived from Streptococcus pneumoniae that are useful in diagnosis and therapy of pathological conditions; antibodies against the polypeptides; and methods for the production of the polypeptides. The invention also provides methods for the detection, prevention and treatment of pathological conditions resulting from bacterial infection.
    Type: Grant
    Filed: May 11, 2007
    Date of Patent: September 1, 2009
    Assignees: Sanofi Pasteur Limited, Sanofi Pasteur Limitée
    Inventors: Lynn Doucette-Stamm, David Bush, Qiandong Zeng, Timothy Opperman, Chad Eric Houseweart
  • Cytochrome c acetylation
    Patent number: 7575883
    Abstract: Modulation of cytochrome c acetylation, e.g., with a SIR polypeptide, enables interventions that modulate lifespan regulation and cell proliferation, e.g., by modulating apoptosis and/or mitochondrial function such as respiration.
    Type: Grant
    Filed: December 15, 2003
    Date of Patent: August 18, 2009
    Assignee: Elixir Pharmaceuticals, Inc.
    Inventors: L. Julie Huber, Jonathan M. Solomon
  • Process for L-amino acid production using enterobacteriaceae strains with enhanced yibD
    Patent number: 7575905
    Abstract: The invention relates to a process for the preparation of L-amino acids by the fermentation of recombinant microorganisms of the family Enterobacteriaceae. The microorganisms produce the desired L-amino acid and overexpress the E. coli or S. typhimurium yibD gene encoding the putative glycosyl transferase enzyme. The microorganisms are cultivated in a medium under conditions in which the desired L-amino acid is enriched in the medium or in the cells. The amino acid is then isolated, optionally with constituents of the fermentation broth, and/or all or part (?0 to 100%) of the biomass.
    Type: Grant
    Filed: March 8, 2004
    Date of Patent: August 18, 2009
    Assignee: Evonik Degussa GmbH
    Inventors: Mechthild Rieping, Nicole Dusch
  • Nucleic acid encoding endolysin fusion protein
    Patent number: 7572602
    Abstract: The invention concerns a recombinant nucleic acid molecule encoding an antimicrobial fusion peptidoglycan endopeptidase. The recombinant nucleic acid molecule according to the invention is formed from a nucleic acid encoding a bacterial endopeptidase (lysostaphin) from Staphylococcus simulans and a nucleic acid encoding a second endopeptidase (endolysin) module from Group B streptococcal bacteriophage B30. The encoded fusion endopeptidase has antimicrobial activity and kills both Staphylococcus bacteria and Streptococcus bacteria.
    Type: Grant
    Filed: December 5, 2005
    Date of Patent: August 11, 2009
    Assignee: The United States of America as represented by the Secretary of Agriculture
    Inventor: David M. Donovan
  • P53 dependent apoptosis-associated gene and protein
    Patent number: 7569351
    Abstract: A novel apoptosis-associated gene p53AIPI is isolated by screening for a gene the expression of which is induced by p53. Since the protein encoded by this gene has an activity of inducing apoptosis, this gene is useful in developing effective therapeutic agents for cancer mediated by apoptosis. A method of screening for a compound controlling the induction of apoptosis which is expected as being useful in developing an apoptosis controlling agent.
    Type: Grant
    Filed: August 2, 2001
    Date of Patent: August 4, 2009
    Assignee: Oncotherapy Science, Inc.
    Inventors: Yusuke Nakamura, Hirofumi Arakawa
  • PUFA polyketide synthase systems and uses thereof
    Patent number: 7563604
    Abstract: The invention generally relates to polyunsaturated fatty acid (PUFA) polyketide synthase (PKS) systems, to homologues thereof, to isolated nucleic acid molecules and recombinant nucleic acid molecules encoding biologically active domains of such a PUFA PKS system, to genetically modified organisms comprising PUFA PKS systems, to methods of making and using such systems for the production of bioactive molecules of interest, and to novel methods for identifying new bacterial and non-bacterial microorganisms having such a PUFA PKS system.
    Type: Grant
    Filed: July 16, 2007
    Date of Patent: July 21, 2009
    Assignee: Martek Biosciences Corporation
    Inventors: James G. Metz, Craig A. Weaver, William R. Barclay, James H. Flatt
  • PUFA polyketide synthase systems and uses thereof
    Patent number: 7563605
    Abstract: The invention generally relates to polyunsaturated fatty acid (PUFA) polyketide synthase (PKS) systems, to homologues thereof, to isolated nucleic acid molecules and recombinant nucleic acid molecules encoding biologically active domains of such a PUFA PKS system, to genetically modified organisms comprising PUFA PKS systems, to methods of making and using such systems for the production of bioactive molecules of interest, and to novel methods for identifying new bacterial and non-bacterial microorganisms having such a PUFA PKS system.
    Type: Grant
    Filed: July 16, 2007
    Date of Patent: July 21, 2009
    Assignee: Martek Biosciences Corporation
    Inventors: James G. Metz, Craig A. Weaver, William R. Barclay, James H. Flatt
  • PUFA polyketide synthase systems and uses thereof
    Patent number: 7563603
    Abstract: The invention generally relates to polyunsaturated fatty acid (PUFA) polyketide synthase (PKS) systems, to homologues thereof, to isolated nucleic acid molecules and recombinant nucleic acid molecules encoding biologically active domains of such a PUFA PKS system, to genetically modified organisms comprising PUFA PKS systems, to methods of making and using such systems for the production of bioactive molecules of interest, and to novel methods for identifying new bacterial and non-bacterial microorganisms having such a PUFA PKS system.
    Type: Grant
    Filed: July 16, 2007
    Date of Patent: July 21, 2009
    Assignee: Martek Biosciences Corporation
    Inventors: James G. Metz, Craig A. Weaver, William R. Barclay, James H. Flatt
  • Modified factor VIII
    Patent number: 7560107
    Abstract: Modified porcine factor VIII is disclosed in which most of the B domain has been removed through genetic engineering. This modified factor VIII is particularly useful for treatment of hemophiliacs, especially those undergoing bleeding episodes.
    Type: Grant
    Filed: October 17, 2006
    Date of Patent: July 14, 2009
    Assignee: Emory University
    Inventor: John S. Lollar
  • Exogenous proteases for plant activation of insect toxin
    Patent number: 7556936
    Abstract: Compositions and methods for protecting a plant from an insect pest are provided. In particular, nucleic acid sequences encoding insect protoxins modified to comprise at least one proteolytic activation site that is sensitive to a plant protease or an insect gut protease are provided. Cleavage of the modified protoxin at the proteolytic activation site by a protease produces an active insect toxin. Methods of using the modified insect protoxin nucleic acid sequences and the polypeptides they encode to protect a plant from an insect pest are provided. Particular embodiments of the invention further provide modified insect protoxin compositions and formulations, expression cassettes, and transformed plants, plant cells, and seeds.
    Type: Grant
    Filed: December 5, 2007
    Date of Patent: July 7, 2009
    Assignees: Pioneer Hi-Bred International, Inc., E.I. du Pont de Nemours and Company
    Inventors: Andre R. Abad, Ronald D. Flannagan, Rafael Herrmann, Albert L. Lu, Billy F. McCutchen, James K. Presnail, Janet A. Rice, James F. Wong, Cao-Guo Yu
  • Branched neutral amino acid transporters acting as single molecule
    Patent number: 7553642
    Abstract: It is intended to provide amino acid transporters which act as a single molecule and transport neutral amino acids typified by branched amino acids, and genes thereof. A protein consisting of an amino acid sequence represented by SEQ ID NO:2, 4, 6 or 8 or an amino acid sequence derived from an amino acid sequence represented by SEQ ID NO:2, 4, 6 or 8 by deletion, substitution or addition of one to several amino acids, and being capable of sodium-independently transporting neutral amino acids typified by branched amino acids and analogs thereof as a single molecule. A gene which is a DNA consisting of a base sequence represented by SEQ ID NO:1, 3, 5 or 7 or a DNA hybridizable with it and encodes a protein capable of sodium-independently transporting branched amino acids as a single molecule.
    Type: Grant
    Filed: March 5, 2004
    Date of Patent: June 30, 2009
    Assignee: Human Cell Systems, Inc.
    Inventors: Hitoshi Endou, Yoshikatsu Kanai
  • Method for production of alpha-amylase in recombinant
    Patent number: 7550281
    Abstract: Disclosed is a novel recombinant Bacillus bacterial strain constructed by genetic engineering which has high productivity of aipha-amylase. The Bacillus strain comprises an alpha-amylase gene inserted in the Bacillus chromosome under transcriptional control of a phage promoter. An efficient process for the rapid production of large amounts of alpha-amylase is also disclosed.
    Type: Grant
    Filed: August 7, 2002
    Date of Patent: June 23, 2009
    Assignee: The Hong Kong Polytechnic University
    Inventors: Yun Chung Leung, Wai Hung Lo, Jeffery Errington
  • Glucose dehydrogenase
    Patent number: 7550274
    Abstract: Disclosed is a modified glucose dehydrogenase having pyrroloquinoline quinone as a coenzyme, wherein one or more amino acid residues in a region of 186-206 amino acid of water-soluble PQQGDH derived from Acinetobacter calcoaceticus or in an equivalent region from other species are replaced with other amino acid residues. Also disclosed is a gene coding for the modified glucose dehydrogenase of the invention, a vector comprising the gene of the invention and a transformant comprising the vector, as well as a glucose assay kit and a glucose sensor comprising the modified glucose dehydrogenase of the invention.
    Type: Grant
    Filed: July 2, 2003
    Date of Patent: June 23, 2009
    Assignee: Ultizyme International Ltd.
    Inventor: Koji Sode
  • Recombinant hexose oxidase, a method of producing same and use of such enzyme
    Patent number: 7544795
    Abstract: A method of producing hexose oxidase by recombinant DNA technology, recombinant hexose oxidase and the use of such enzyme, in particular in the manufacturing of food products such as doughs and dairy products, animal feed, pharmaceuticals, cosmetics, dental care products and in the manufacturing of lactones. Suitable sources of DNA coding for the enzyme are marine algal species including Chondrus crispus, Iridophycus flaccidum and Euthora cristata. In useful embodiments, the recombinant hexose oxidase is produced by Pichia pastoris, Saccharomyces cerevisiae or E. coli.
    Type: Grant
    Filed: August 17, 2004
    Date of Patent: June 9, 2009
    Assignee: Danisco A/S
    Inventors: Peter Stougaard, Ole Cai Hansen
  • Anti-inflammatory compounds and uses thereof
    Patent number: 7538089
    Abstract: The present invention provides anti-inflammatory compounds, pharmaceutical compositions thereof, and methods of use thereof for treating inflammatory disorders. The present invention also provides methods of identifying anti-inflammatory compounds and methods of inhibiting NF-?B-dependent target gene expression in a cell.
    Type: Grant
    Filed: November 1, 2004
    Date of Patent: May 26, 2009
    Assignee: Yale University
    Inventors: Michael J. May, Sankar Ghosh
  • Glyphosate-N-acetyltransferase (GAT) genes
    Patent number: 7531339
    Abstract: Novel proteins are provided herein, including proteins capable of catalyzing the acetylation of glyphosate and other structurally related proteins. Also provided are novel polynucleotides capable of encoding these proteins, compositions that include one or more of these novel proteins and/or polynucleotides, recombinant cells and transgenic plants comprising these novel compounds, diversification methods involving the novel compounds, and methods of using the compounds. Some of the novel methods and compounds provided herein can be used to render an organism, such as a plant, resistant to glyphosate.
    Type: Grant
    Filed: April 17, 2006
    Date of Patent: May 12, 2009
    Assignees: Verdia, Inc., Pioneer Hi-Bred International, Inc.
    Inventors: Linda A. Castle, Dan Siehl, Lorraine Giver, Jeremy Minshull, Cristina Ivy, Yong Hong Chen, Nicholas B. Duck, Phillip A. Patten
  • Papillosin antimicrobial peptide, a gene coding said peptide, a vector, a transformed organism and a compound containing said organism
    Patent number: 7531509
    Abstract: An antimicrobial peptide isolated from an extract from a marine invertebrate, whose amino acid sequence is as follows: GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ (SEQ ID No. 1), its derivatives, its fragments and a polypeptide, as well as transformed host organisms capable of producing the peptide such as microorganisms, animal cells, digital cells and plants, and an anti-microbial composition containing the peptide.
    Type: Grant
    Filed: March 5, 2004
    Date of Patent: May 12, 2009
    Assignees: Centre National de la Recherche Scientifique—CNRS, Universite de Perpignan
    Inventors: Guillaume Mitta, Richard Galinier, Bernard Banaigs, Eric Lasserre