Patents Examined by Roy Teller
  • Patent number: 9316650
    Abstract: The invention concerns the field of detecting and quantifying misfolded proteins/peptides. In particular the detection and quantification of misfolded proteins/peptides in body fluids, on cell surfaces of humans and mammals, the detection of misfolded proteins/peptides in reagents to be tested for scientific research and/or diagnostic use and in pharmaceutical medication or their additives and it concerns as well the removal of misfolded proteins/peptides from reagents to be tested for scientific research and/or for diagnostic purposes and from pharmaceutical medication or their additives.
    Type: Grant
    Filed: February 10, 2012
    Date of Patent: April 19, 2016
    Assignee: OXPROTECT GMBH
    Inventors: Beate Kehrel, Martin Brodde
  • Patent number: 9309288
    Abstract: The present invention is related to new peptide antagonists of ?v?3 receptor, designed on the basis of the crystal structure of integrin ?v?3 in complex with c(RGDf[NMe]V) and the NMR structure of echistatin. These peptides are potent and selective antagonists of the ?v?3 receptor and can be used as novel anticancer drugs and/or new class of diagnostic non-invasive tracers as suitable tools for ?v?3-targeted therapy and imaging.
    Type: Grant
    Filed: August 30, 2013
    Date of Patent: April 12, 2016
    Assignee: ADVANCED ACCELERATOR APPLICATIONS
    Inventors: Annarita Del Gatto, Laura Zaccaro, Carlo Pedone, Michele Saviano
  • Patent number: 9295754
    Abstract: This disclosure relates to compounds and compositions for forming bone and methods related thereto. In certain embodiments, the disclosure relates to methods of forming bone comprising implanting a bone graft composition comprising a growth factor such as BMP in a subject at a site of desired bone growth or enhancement in combination with a Noggin blocker.
    Type: Grant
    Filed: February 23, 2012
    Date of Patent: March 29, 2016
    Assignees: Emory University, The United States Government as represented by the Department of Veterans Affairs
    Inventors: Scott D. Boden, Sreedhara Sangadala
  • Patent number: 9279004
    Abstract: The present invention relates to a synthetic peptide of 19 amino acids, called PnTx(19), constituted from the sequence of the native toxin PnTx2-6 of the Phoneutria nigriventer spider. It also relates to pharmaceutical compositions containing such a peptide and to the use thereof in the treatment of erectile dysfunction and/or in potentiating the erectile function.
    Type: Grant
    Filed: August 20, 2013
    Date of Patent: March 8, 2016
    Assignee: UNIVERSIDADE FEDERAL DE MINAS GERAIS—UFMG
    Inventors: Maria Elena De Lima Perez Garcia, Carolina Nunes Da Silva, Flávia De Marco Almeida, Rosangela Da Silva Lomeo, Paulo Sérgio Lacerda Beirão, Fernanda Silva Torres, Adriano Monteiro De Castro Pimenta
  • Patent number: 9260536
    Abstract: A method of preparing a capturing agent for a selected biopolymer or bioparticle, includes the steps of: a) selecting a desired biopolymer or bioparticle, and b) providing a support matrix modified to have, at predetermined conditions, such a net negative surface charge and net surface hydrophobicity in relation to the net negative surface charge and the net surface hydrophobicity of the selected biopolymer or bioparticle that the modified support matrix is capable of selective interaction and capture of the biopolymer or bioparticle through a resulting net hydrophobic interaction being the actual hydrophobic interaction minus the actual electrostatic repulsion. The use of such a capturing agent as a therapeutically active substance, as well as in chromatography and diagnosis are also disclosed.
    Type: Grant
    Filed: July 20, 2012
    Date of Patent: February 16, 2016
    Inventor: Stellan Hjerten
  • Patent number: 9249183
    Abstract: Method for identifying a modulator of Sirt6, PfSir2a, or Sirt7 deacylase activity, wherein a fatty-acylated substrate containing an acyl-lysine moiety and an indicator moiety is contacted with Sirt6, PfSir2a, or Sirt7 in the presence of a candidate compound under conditions for Sirt6, PfSir2a, or Sirt7 to deacylate the substrate, wherein the acyl is a hydrophobic fatty acyl group containing a hydrocarbon group having at least three carbon atoms connected by carbon-carbon bonds; contacting the deacylated substrate with a cleavage agent that cleaves the linkage between the lysine and indicator moiety to generate a detectable signal; and correlating a quantified Sirt6, PfSir2a, or Sirt7 deacylase activity therefrom. Modulating compounds of Sirt6, PfSir2a, or Sirt7 deacylase activity are also described, as are pharmaceutical compositions thereof, methods of treatment by administration of the modulating compounds, and kits for practicing the method.
    Type: Grant
    Filed: December 21, 2011
    Date of Patent: February 2, 2016
    Assignee: CORNELL UNIVERSITY
    Inventor: Hening Lin
  • Patent number: 9243028
    Abstract: Provided are methods for forming a reactive S-nitroso thioacid (NTA), comprising nitrosation of a thioacid with a nitrosation reagent. Also provided are methods for: acylating a nucleophile including selective acylation with a high degree of selectivity toward amines over hydroxyls; amide or peptide bond formation; forming a dipeptide or polypeptide; and peptide coupling/ligation, comprising use of thioacid and amine starting materials, wherein the reactions are mediated by very reactive S-nitroso thioacid (NTA) intermediates enabling extremely fast reactions under mild conditions, providing for broad applications.
    Type: Grant
    Filed: January 26, 2012
    Date of Patent: January 26, 2016
    Assignee: Washington State University
    Inventors: Ming Xian, Jia Pan
  • Patent number: 9242011
    Abstract: Insulin albumin conjugates consisting of an insulin analogue, a bifunctional linker and albumin can efficiently be used to treat diabetic patients.
    Type: Grant
    Filed: March 31, 2009
    Date of Patent: January 26, 2016
    Assignee: Novo Nordisk A/S
    Inventors: Tina Møller Tagmose, Peter Madsen, Thomas Børglum Kjeldsen
  • Patent number: 9238058
    Abstract: Reconstituted surfactants comprising a lipid carrier, a polypeptide analog of the native surfactant protein SP-C, and a polypeptide analog of the native surfactant protein SP-B are useful for the treatment and/or prophylaxis of RDS and other respiratory disorders.
    Type: Grant
    Filed: April 10, 2012
    Date of Patent: January 19, 2016
    Assignee: CHIESI FARMACEUTICI S.p.A.
    Inventors: Jan Johansson, Tore Curstedt, Joakim Robertson, Soeren Robertson, Magnus Robertson, Charlotte Robertson, Gertie Robertson Grossmann
  • Patent number: 9238083
    Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.
    Type: Grant
    Filed: September 29, 2010
    Date of Patent: January 19, 2016
    Assignees: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Patent number: 9232784
    Abstract: Disclosed herein is an RGD-enriched solubilized extracellular matrix composition derived from endothelial cell culture that can be used to modify the immunogenicity or thrombogenicity of an organ intended for transplant. The RGD-enriched solubilized extracellular matrix composition is applied to the lumen of the vasculature of the organ, thereby placing a barrier between the antigens on the lumenal surfaces of the transplanted organ and the blood of the recipient.
    Type: Grant
    Filed: November 5, 2013
    Date of Patent: January 12, 2016
    Assignee: Breonics Inc.
    Inventor: Lauren Brasile
  • Patent number: 9198956
    Abstract: This document provides methods and materials related to treating liver conditions. For example, the methods and materials relating to the use of cAMP inhibitors to treat liver conditions are provided.
    Type: Grant
    Filed: March 23, 2015
    Date of Patent: December 1, 2015
    Assignee: Mayo Foundation for Medical Education and Research
    Inventors: Nicholas F. LaRusso, Tetyana V. Masyuk, Melissa Muff-Luett
  • Patent number: 9193775
    Abstract: The present technology relates to well-defined oligomers comprising two or more monomers wherein each monomer is independently selected from a ubiquitin polypeptide or a ubiquitin-like polypeptide, and the monomers are covalently linked to each other via a thioether group or groups. Further provided are monomer building blocks and methods of making the monomers and oligomers.
    Type: Grant
    Filed: March 8, 2013
    Date of Patent: November 24, 2015
    Assignee: WISCONSIN ALUMNI RESEARCH FOUNDATION
    Inventors: Eric Strieter, Ellen Valkevich, Robert Guenette
  • Patent number: 9175037
    Abstract: An object of the present invention is to provide a novel anorectic agent. Another object of the invention is to provide an NMU derivative which exhibits a high anorectic effect even when administered in a usual manner, for example, peripherally. These objects can be achieved by the compound represented by formula (I) or a salt thereof. In formula (I), Y represents a polypeptide containing an amino acid sequence set forth in SEQ ID NO.: 1 wherein 1 to 4 amino acids are substituted; X represents a methoxypolyethylene glycol; X? is absent or represents a methoxypolyethylene glycol; and a moiety represented by formula: La-Lb-[Lc]j represents a linker.
    Type: Grant
    Filed: April 8, 2010
    Date of Patent: November 3, 2015
    Assignee: Takeda Pharmaceutical Company Limited
    Inventors: Taiji Asami, Hiroshi Inooka, Naoki Nishizawa
  • Patent number: 9168290
    Abstract: Disclosed are compositions and methods for decreasing the viscosity and/or cohesiveness of and/or increasing the liquefaction of excessively or abnormally viscous or cohesive mucus or sputum. The composition contains a protein or peptide containing a thioredoxin monocysteinic active site in a reduced state and optionally further contains a reducing system.
    Type: Grant
    Filed: March 17, 2014
    Date of Patent: October 27, 2015
    Assignee: OrPro Therapeutics, Inc.
    Inventor: Peter B. Heifetz
  • Patent number: 9169307
    Abstract: Compounds comprising peptides and peptidomimetics capable of binding C3 protein and inhibiting complement activation are disclosed. These compounds display greatly improved complement activation-inhibitory activity as compared with currently available compounds.
    Type: Grant
    Filed: January 14, 2011
    Date of Patent: October 27, 2015
    Assignee: The Trustees of the University of Pennsylvania
    Inventors: John D. Lambris, Madan Katragadda
  • Patent number: 9125969
    Abstract: Comblike, surfactant polymers for changing the surface properties of biomaterials are provided. Such surfactant polymers comprise a polymeric backbone of repeating monomeric units having functional groups for coupling with side chains, a plurality of hydrophobic side chains linked to the backbone via the functional groups, and a plurality of hydrophilic side chains linked to said backbone via the functional groups. Medical devices coated with the surfactant polymers are also provided. The surfactant polymers may be used to decrease the thrombogenic properties, encapsulation, and bacterial colonization of medical devices.
    Type: Grant
    Filed: March 16, 2012
    Date of Patent: September 8, 2015
    Assignee: NANOMIMETICS, INC.
    Inventors: Jan J. Lewandowski, Yubiao Liu, Roger Marchant, Tianhong Zhang, Yongxing Qiu, Mark A. Ruegsegger
  • Patent number: 9127075
    Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogs and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.
    Type: Grant
    Filed: July 5, 2011
    Date of Patent: September 8, 2015
    Assignee: SHENYANG PHARMACEUTICAL UNIVERSITY
    Inventors: Jianhai Zhang, Zhou Yang, Yanfeng Liu, Chunfu Wu
  • Patent number: 9109048
    Abstract: The present invention provides a cytotoxic 7 to 25 mer peptide with three or more cationic residues which has one or more non-genetic bulky and lipophilic amino acids, as well as esters, amides, salts and cyclic derivatives thereof as well as methods of preparing the peptides, pharmaceutical compositions containing them and their use as medicaments, particularly as antibacterions or antitumoral agents. In a preferred aspect, the invention provides the use of said peptides in a method of inducing adaptive immunity against tumor growth or establishment in a subject, as well as the use of other lytic agents in a method of inducing adaptive immunity in a subject.
    Type: Grant
    Filed: August 14, 2012
    Date of Patent: August 18, 2015
    Assignee: LYTIX BIOPHARMA AS
    Inventors: Liv Tone Eliassen, Gerd Berge, Baldur Sveinbjørnsson, John Sigurd Svendsen, Øystein Rekdal
  • Patent number: 9096643
    Abstract: A peptide comprising the amino acid sequence, X1X2RX3DX4X5X6X7 is provided, as well as a biomaterial comprising the peptide for use to treat conditions resulting from cell death or apoptosis.
    Type: Grant
    Filed: August 26, 2011
    Date of Patent: August 4, 2015
    Inventors: Milica Radisic, Susan Dallabrida, Maria Ann Rupnick