Abstract: A molecule which (i) binds human membrane-bound carcinoembryonic antigen, (ii) binds a hybrid polypeptide consisting of residues 1 to 314 of human biliary glycoprotein joined (N-C) to residues 490 to C-terminus of human carcino embryonic antigen, but (iii) does not bind to human biliary glycoprotein excluding an intact mouse monoclonal antibody comprising an IgG group IIA heavy chain and a kappa group V light chain wherein the sequence of the V.sub.H chain is QVKLQQSGPELKKPGETVKISCKASGYTFTVFGMNWVKQAPGKGLKWMGWIN-TKTGEATYVEEFKGRFAFSLE TSATTAYLQINNLKNEDTAKYFCARWDFYDYVEAMDYWGQGTTVTVSS, or wherein the sequence of the V.sub.H chain is as given immediately above but the first amino acid residue of the V.sub.H CDR1 is glutamine and in either case the sequence of the V.sub.L chain is GDIVMTQSQRFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSG-SGTDFT LTISNVQSEDLAEYFCHQYYTYPLFTFGSGTKLEMKR. Preferably the molecule is a monoclonal antibody.

Abstract: A substance secreted or shed by muscle cells and white blood cells is disclosed. This novel substance is active in inhibiting proliferation of tumor cells and proliferation of stimulated lymphocytes. The substance does not inhibit proliferation of normal cells. This substance is used in accordance with the invention for treatment or prevention of cancer and the level of said substance in a body fluid or in a fluid conditioned by the growth therein of cells withdrawn from the individual, is used for the diagnosis of cancer or the level of risk of the individual of developing cancer.

Abstract: A method for treating multiple sclerosis, through the administration of anti-tumour necrosis factor antibody, of soluble tumour necrosis factor receptor or of a compound capable of blocking tumour necrosis factor production, its effects and/or tumour necrosis factor receptor signal transduction, is disclosed. The method can be used to aid in therapy for humans and other mammals.

Abstract: Polynucleotide and polypeptide sequences encoding a novel tumor suppressor gene, DPC4, are provided. Also included is a method for detecting a cell proliferative disorder associated with DPC4. DPC4 is a marker which can be used diagnostically, prognostically and therapeutically over the course of disorders associated with DPC4.

Abstract: The invention relates to methods for manipulating nucleic acids so as to optimize the binding characteristics of an encoded binding protein by providing two or more nucleic acids encoding binding proteins having at least one set of splicing sites, the set of splicing sites flanking opposite ends of one or more encoded binding domains; mixing the nucleic acids to produce a parent population of mixed nucleic acids encoding binding proteins; and randomly incorporating the binding domains between the nucleic acids through the set of splicing sites to produce a different population of nucleic acids encoding binding proteins wherein at least one binding protein is characterized by substantially different binding characteristics than a member of the parent population.

Abstract: The subject invention provides a naturally occurring antigen indicative of the presence of atherosclerotic plaque. The subject invention provides a murine-human chimeric monoclonal antibody which specifically binds to an antigen indicative of the presence of atherosclerotic plaque; and methods and reagents involving the use of the murine-human chimeric monoclonal antibody. The subject invention provides a CDR-grafted antibody; and methods and reagents involving the use of the CDR-grafted antibody. The subject invention provides a surrogate antigen; methods and reagents involving the use of the surrogate antigen, preparation of the surrogate antigen, antibodies generated from the surrogate antigen.

Abstract: Improved affinity purification media are provided by the use of small specific binding agents, especially Fv antibody fragments or single domain antibody fragments, immobilised on porous carriers having pore sizes in the range 30-1000 angstroms, preferably 30-300 angstroms. Silica is a preferred carrier. The small fragments are able to penetrate the pores and maximise the effective surface area of the carrier, and the microporous silica is sufficiently robust to be used at high pressure, so enabling the speed and/or throughput of a purification procedure to be increased.

Abstract: The invention provides two human longevity-assurance protein homologs, designated individually as LAPH-1 and LAPH-2 and collectively as LAPH, and polynucleotides which identify and encode LAPH. The invention also provides expression vectors, host cells, agonists, antibodies and antagonists. The invention also provides methods for treating disorders associated with expression of LAPH.

Abstract: The present invention is related to single and double chain antibodies to EGF receptor. The invention also relates to toxin conjugates of such antibodies. These antibodies are useful for treating and diagnosing the status of pathological conditions such as cancer and cellular hyper proliferation.

Abstract: A semi-automated method of classifying a histological specimen for the presence of premalignant or malignant cells, including the steps of treating a specimen with an immunohistochemical marker to provide a visual indication of cell proliferation, ranking individual objects in the specimen in an order according to the likelihood that each object has attributes consistent with a premalignant or malignant cell or cell cluster, selecting for display a set of said objects according to said ranking, and displaying images of said selected objects to facilitate review by an operator.

Abstract: According to the method of the invention, immunoassays are applied to measure free PSA as well as a proteinase inhibitor complex. Free PSA and PSA complex are according to the invention measured by a non-competitive immunoassay employing at least two different monoclonal antibodies. The invention is further characterized by that the PSA proteinase inhibitor complex of interest is formed either with .alpha..sub.1 -antichymotrypsin, .alpha..sub.1 -protease inhibitor (API) or .alpha..sub.2 -macroglobulin. Moreover, the invention is characterized by that free PSA, the PSA-proteinase inhibitor complex and their ratio are applied in the diagnosis of patients with prostate cancer.

Abstract: The present invention relates to immunogenic complexes of heat shock proteins (hsp) noncovalently bound to exogenous antigenic molecules which when administered to an individual elicit specific immunological responses in the host. Methods of prevention and treatment of cancer and infectious disease are provided.

Abstract: The invention provides a human annexin binding protein (NABP-1) and polynucleotides which identify and encode NABP-1. The invention also provides expression vectors, host cells, agonists, antibodies and antagonists. The invention also provides methods for treating disorders associated with expression of NABP-1.

Abstract: The invention provides a method for the expression of recombinant molecules in bacterial hosts in a defined medium in the absence of antibiotic selection. The method uses an expression vector comprising a regulatable promoter by which the production of foreign proteins may be controlled during the growth phase of the culture, an origin of replication maintaining medium vector copy number and a transcriptional terminator.

Abstract: In vitro methods of determining whether or not an individual has metastasized colorectal cancer cells are disclosed. In vitro methods of determining whether or not tumor cells are colorectal in origin are disclosed. In vitro kits for practicing the methods of the invention and to reagents and compositions useful to practice the methods, for example as components in such in vitro kits of the invention are provided. Methods of and kits and compositions for analyzing tissue samples from the colon tissue to evaluate the extent of metastasis of colorectal tumor cells are disclosed.

Abstract: The subject invention provides an antibody which specifically binds to the product of a reaction between a labeling substance and a substrate. The subject invention also provides a method of making an immunogen used to produce the antibody of the subject invention. The invention further provides methods of using the subject antibody for detecting an antigen of interest in a sample, for example, detecting a protein comprising an amino acid sequence of interest and detecting a nucleic acid molecule comprising a nucleic acid sequence of interest, detecting a polypeptide such as those expressed by infectious agents, fungi or parasites.

Abstract: This invention relates to identification of a new key marker, namely, 9-O-Acetylated Sialoglycoconjugate with the help of a known 9-O-Acetylsialic acid binding lectin, AchatininH useful for the detection of minimal residual disease (MRD) and prediction of relapse by a lymphoproliferation assay in acute lymphoblastic leukaemia (ALL).

Abstract: Therapeutic multispecific compounds comprised of anti-Fc.alpha. receptor antibodies and methods of use are provided.

Abstract: Treatment of tumor necrosis factor, TNF, mediated pathologies is provided by administering anti-TNF compounds, such as anti-TNF antibodies and anti-TNF peptides, which compounds are specific for tumor necrosis factor-.alpha. (TNF.alpha.) or tumor necrosis factor-.beta. (TNF.beta.) and which are useful for in vivo therapy or diagnosis of TNF.alpha.-mediated pathologies and conditions, wherein the anti-TNF compound is selected from the group consisting of at least one of an immunoglobulin variable region, a fragment of a TNF receptor and an anti-TNF peptide, such as a structural analog of a anti-TNF antibody fragment or a TNF receptor fragment.

Abstract: The invention concerns an antibody active against an epitope coded by the exon v6 variant of the CD44 gene. The antibody concerned has characteristics superior to those of prior art antibodies and is suitable for use in therapy and diagnosis.