Patents by Inventor Agnes Labigne

Agnes Labigne has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 7517666
    Abstract: This application relates to methods of screening molecules capable of inhibiting the survival of Helicobacter pylori in vivo by specifically inhibiting the activity of UreI, to the molecules identified by these methods, and to the use of these molecules to treat or prevent H. pylori infection.
    Type: Grant
    Filed: March 2, 2005
    Date of Patent: April 14, 2009
    Assignee: Institut Pasteur
    Inventors: Hilde De Reuse, Stéphane Skouloubris, Valérie Cussac, Agnés Labigne
  • Publication number: 20050176077
    Abstract: This application relates to methods of screening molecules capable of inhibiting the survival of Helicobacter pylori in vivo by specifically inhibiting the activity of UreI, to the molecules identified by these methods, and to the use of these molecules to treat or prevent H. pylori infection.
    Type: Application
    Filed: March 2, 2005
    Publication date: August 11, 2005
    Inventors: Hilde De Reuse, Stephane Skouloubris, Valerie Cussac, Agnes Labigne
  • Publication number: 20050147988
    Abstract: The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to aflagellate bacterial strains. The invention also relates to the use of these means for detecting an infection due to H. pylori or for protecting against such an infection.
    Type: Application
    Filed: August 26, 2004
    Publication date: July 7, 2005
    Inventors: Sebastian Suerbaum, Agnes Labigne
  • Patent number: 6899881
    Abstract: The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to a aflagellate bacterial strains. The invention also relates to the use of these means for detecting an infection due to H.pylori or for protecting against such an infection.
    Type: Grant
    Filed: September 10, 2002
    Date of Patent: May 31, 2005
    Assignees: Institut Pasteur, Institute National de la Sante et de la Recherche Medicale
    Inventors: Sebastian Suerbaum, Agnés Labigne
  • Patent number: 6838273
    Abstract: The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to aflagellate bacterial strains. The invention also relates to the use of these means for detecting an infection due to H.pylori or for protecting against such an infection.
    Type: Grant
    Filed: January 29, 1998
    Date of Patent: January 4, 2005
    Assignee: Institut Pasteur and Institut National de la Sante et de la Recherche Medicale
    Inventors: Sebastian Suerbaum, Agnès Labigne
  • Patent number: 6762051
    Abstract: This invention relates to methods of screening molecules capable of inhibiting the survival of Helicobacter pylori in vivo by specifically inhibiting the activity of UreI, to the molecules identified by these methods, and to the use of these molecules to treat or prevent H. pylori infection.
    Type: Grant
    Filed: December 22, 2000
    Date of Patent: July 13, 2004
    Assignee: Institut Pasteur
    Inventors: Hilde De Reuse, Stéphane Skouloubris, Valérie Cussac, Agnés Labigne
  • Publication number: 20040115772
    Abstract: A method of treating or preventing Helicobacter infection in humans or animals comprising the step of administering a molecule, such as a molecule that can interact with UreI, capable of inhibiting the growth or survival of Helicobacter in vivo to a human or animal in need of such treatment.
    Type: Application
    Filed: November 25, 2003
    Publication date: June 17, 2004
    Inventors: Hilde De Reuse, Stephane Skouloubris, Valerie Cussac, Agnes Labigne
  • Publication number: 20030195349
    Abstract: The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to aflagellate bacterial strains. The invention also relates to the use of these means for detecting an infection due to H.pylori or for protecting against such an infection.
    Type: Application
    Filed: September 10, 2002
    Publication date: October 16, 2003
    Applicant: Institut Pasteur and Institut National De La Sante Et De La Recherche Medicale
    Inventors: Sebastian Suerbaum, Agnes Labigne
  • Publication number: 20030152579
    Abstract: The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to aflagellate bacterial strains. The invention also relates to the use of these means for detecting an infection due to H.pylori or for protecting against such an infection.
    Type: Application
    Filed: January 29, 1998
    Publication date: August 14, 2003
    Applicant: INSTITUT PASTEUR AND INSTITUT NATIONAL DE LA SANTE
    Inventors: SEBASTIAN SUERBAUM, AGNES LABIGNE
  • Publication number: 20020192796
    Abstract: Disclosed are polypeptides named HP1122, Cj1464 and PA3351 which are the anti-&sgr;28 factor of Helicobacter pylori, Campylobacter jejuni and Pseudomonas aeruginosa, respectively and fragments and variants thereof. Also disclosed is a polypeptide named SID1122 which is the domain of Helicobacter pylori's HP1122 polypeptide involved in a specific interaction with Helicobacter pylori &sgr;28 (HP1032) and which has an anti-&sgr;28 factor activity.
    Type: Application
    Filed: January 31, 2002
    Publication date: December 19, 2002
    Inventors: Pierre Legrain, Frederic Colland, Jean-Christophe Rain, Agnes Labigne, Hilde De Reuse
  • Patent number: 6476213
    Abstract: The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to aflagellate bacterial strains. The invention also relates to the use of these means for detecting an infection due to H . pylori or for protecting against such an infection.
    Type: Grant
    Filed: June 28, 1996
    Date of Patent: November 5, 2002
    Assignees: Institut Pasteur, Institut National de la Sante et de la Recherche Medicale
    Inventors: Sebastian Suerbaum, Agnès Labigne
  • Publication number: 20020102269
    Abstract: This invention relates to methods of screening molecules capable of inhibiting the survival of Helicobacter pylori in vivo by specifically inhibiting the activity of UreI, to the molecules identified by these methods, and to the use of these molecules to treat or prevent H. pylori infection.
    Type: Application
    Filed: December 22, 2000
    Publication date: August 1, 2002
    Inventors: Hilde De Reuse, Stephane Skouloubris, Valerie Cussac, Agnes Labigne
  • Patent number: 6416968
    Abstract: This invention relates to methods of screening molecules capable of inhibiting the survival of Helicobacter pylori in vivo by specifically inhibiting the activity of UreI, to the molecules identified by these methods, and to the use of these molecules to treat or prevent H. pylori infection.
    Type: Grant
    Filed: August 23, 2000
    Date of Patent: July 9, 2002
    Assignee: Institut Pasteur
    Inventors: Hilde De Reuse, Stéphane Skouloubris, Valérie Cussac, Agnès Labigne
  • Patent number: 6271017
    Abstract: Oligonucletodie sequences are disclosed specific to H. pylori urease and useful as DNA probes and primers in the detection of H. pylori infection in humans.
    Type: Grant
    Filed: June 7, 1995
    Date of Patent: August 7, 2001
    Assignees: Institut Pasteur, Institut National de la Sante et de la Recherche Medicale
    Inventors: Agnès Labigne, Valérie Cussac, Richard Ferrero
  • Patent number: 6258359
    Abstract: There is provided an immunogenic composition capable of inducing protective antibodies against Helicobacter infection characterized in that it comprises: i) at least one sub-unit of a urease structural polypeptide from Helicobacter pylori (SEQ ID NO: 22,26), or a fragment thereof, said fragment being recognized by antibodies reacting with Helicobacter felis urease (SEQ ID NO: 20-21), and/or at least one sub-unit of a urease structural polypeptide from Helicobacter felis (SEQ ID NO: 20-21), or a fragment thereof, said fragment being recognized by antibodies reacting with Helicobacter pylori urease (SEQ ID NO: 22-26); ii) and/or, a heat shock protein (Hsp), or chaperonin, from Helicobacter, or a fragment of said protein. The preparation, by recombinant means, of such immunogenic compositions is also provided.
    Type: Grant
    Filed: June 6, 1995
    Date of Patent: July 10, 2001
    Assignee: Institut Pasteur
    Inventors: Agnes Labigne, Sebastian Suerbaum, Richard L. Ferrero, Jean-Michel Thiberge
  • Patent number: 6248551
    Abstract: This invention relates to Helicobacter species aliphatic amidase AmiE polypeptides, the DNA encoding those polypeptides and transformed microorganisms capable of expressing those polypeptides. This invention also relates to the use of Helicobacter sp. (particularly Helicobacter pylori) amidase AmiE polypeptides and antibodies specific for those polypeptides in immunogenic, therapeutic, and diagnostic applications. The invention additionally relates to processes of producing Helicobacter species aliphatic amidase AmiE polypeptides and intermediates useful in the production of those polypeptides.
    Type: Grant
    Filed: February 23, 1998
    Date of Patent: June 19, 2001
    Assignee: Institut Pasteur
    Inventors: Hilde De Reuse, Stephane Skouloubris, Agnes Labigne
  • Patent number: 6248330
    Abstract: There is provided an immunogenic composition capable of inducing protective antibodies against Helicobacter infection characterized in that it comprises: i) at least one sub-unit of a urease structural polypeptide from Helicobacter pylori, or a fragment thereof, said fragment being recognized by antibodies reacting with Helicobacter felis urease, and/or at least one sub-unit of a urease structural polypeptide from Helicobacter felis, or a fragment thereof, said fragment being recognized by antibodies reacting with Helicobacter pylori urease; ii) and/or, a heat shock protein (Hsp), or chaperonin, from Helicobacter, or a fragment of said protein. The preparation, by recombinant means, of such immunogenic compositions is also provided.
    Type: Grant
    Filed: May 2, 1995
    Date of Patent: June 19, 2001
    Assignee: Institut Pasteur
    Inventors: Agnes Labigne, Sebastien Suerbaum, Richard L. Ferrero, Jean-Michel Thiberge
  • Patent number: 6190667
    Abstract: This invention relates to methods of screening molecules capable of inhibiting the survival of Helicobacter pylori in vivo by specifically inhibiting the activity of UreI, to the molecules identified by these methods, and to the use of these molecules to treat or prevent H. pylori infection.
    Type: Grant
    Filed: June 30, 1998
    Date of Patent: February 20, 2001
    Assignee: Institut Pasteur
    Inventors: Hilde De Reuse, Stéphane Skouloubris, Valérie Cussac, Agnès Labigne
  • Patent number: 6146634
    Abstract: The invention relates more particularly to any nucleotide sequence corresponding, according to the universal genetic code, to at least one part of the following amino acid sequence (VIII) of 61 kDa (coded by the nucleotide sequence (VII)):1MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTTYGEELKFGGGKTLREGM SQSNNPSKEELDLIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNN LSVGPATEALAGEGLIVTAGGIDTHIHFISPQQIPTAFASGVTTMIGGGTGPAD GTNATTTTPGRRNLKWMLRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGF KIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMH TFHTEGAGGGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLD KSIKEDVQFADSRIRPQTIAAEDTLHDMIGIFSITSSDSQAMGRVGEVTTRTWQT ADKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADL VLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYD ANITFVSQAAYDKGIKEELGLERQVLPVKNCRNITKKDMQFNDTTAHIEVNPETY HVFVDGKEVTSKPANKVSLAQLFSIF.sub.--.sbsb.569.Molecular weight: 61,729 daltons.The comparison between the aminoacid sequence (VIII) with the Jack bean urease sequence described in Eur. J. Biochem.
    Type: Grant
    Filed: July 31, 1998
    Date of Patent: November 14, 2000
    Assignee: Institut Pasteur and Institut National de le Sante et de la Recherche Medicale
    Inventor: Agnes Labigne
  • Patent number: 6027878
    Abstract: Oligonucleotide sequences are disclosed specific to H. pylori urease and useful as DNA probes and primers in the detection of H. pylori infection in humans. Also disclosed are methods of hybridization and amplification using these sequences.
    Type: Grant
    Filed: June 7, 1995
    Date of Patent: February 22, 2000
    Assignees: Institut Pasteur, Inistitut National de la Sante et de la Recherche Medicale
    Inventors: Agnes Labigne, Valerie Cussac, Richard Ferrero