Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.

Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.

Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.

Abstract: The disclosure provides a peptide consisting of 10 to 45 amino acids and comprising the amino acid sequence of KILQQSRIVQX, wherein X is absent or S; an amino acid sequence of 10 or more contiguous amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16); or the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9); or a peptide having an amino acid sequence that is different from the amino acid sequence of the former peptide in that 1 to 3 amino acids are substituted, deleted or added and being capable of activating a helper T-cell, as well as products relating to the peptide such as an polynucleotide. The disclosure also provides use of the peptide and the products as a medicament or a composition for activating a helper T-cell.

Abstract: An immunoregulator that is safe and efficiently incorporated into cells along with a production process thereof are provided. Double-stranded RNA derived from lactic acid bacteria, an immunoregulator having for an active ingredient thereof double-stranded RNA derived from lactic acid bacteria, and a process for producing double-stranded RNA derived from lactic acid bacteria are provided. Bacteria cells of a strains of lactic acid bacteria such as genus Tetragenococcus, genus Pediococcus, genus Lactobacillus, genus Streptococcus or genus Leuconostoc are able to produce double-stranded RNA having immunoregulatory action therein.

Abstract: An interferon ? production promoter and a method for producing thereof are provided. The interferon ? production promoter has a culture, a cell or cell components of lactic acid bacteria as an active ingredient thereof. RNA can be used for the cell component. In addition, bacteria belonging to the genus Lactobacillus, Tetragenococcus, Pediococcus or Streptococcus can be used for the lactic acid bacteria. The interferon ? production promoter can be produced by culturing lactic acid bacteria and collecting a culture, a cell or cell components thereof.

Abstract: It is intended to provide an immunomodulator, which has a high safety and can be effectively incorporated into cells, and a method of producing the same. A double-stranded RNA originating in a lactic acid bacterium; an immunomodulator comprising the double-stranded RNA originating in a lactic acid bacterium as the active ingredient; and a method of producing the double-stranded RNA originating in a lactic acid bacterium. Lactic acid bacterial cells belonging to the genus Tetragenococcus, Pediococcus, Lactobacillus, Streptococcus, Leuconostoc, etc. can produce a double-stranded RNA having an immunomodulation effect therein.