Abstract: An apparatus for shaping plastic preforms into plastic containers, including a plurality of blow molding stations which each have a cavity in which the plastic preforms can be shaped into plastic containers. The blow molding stations are arranged on a movable carrier and each have a stretching rod which stretches the plastic containers in their longitudinal direction by a movement in a stretching direction. A fluid-actuated drive device is provided for driving the stretching rod in the stretching direction. The apparatus includes a guide cam which is arranged in a stationary manner and by means of which the stretching rod can be moved counter to the stretching direction as a function of a movement of the blow molding station. At least one portion of the guide cam is adjustable and, for example, by virtue of this adjustment a dependency of the movement of the stretching rod on the movement of the blow molding station can be varied.

Abstract: An apparatus for shaping plastics material pre-forms into plastics material containers has a movable carrier on which are arranged a plurality of shaping stations for shaping the plastics material pre-forms into the plastics material containers. Each shaping station has a stressing device which acts upon the plastics material pre-forms for the expansion thereof with a gaseous medium, and a pressure preparation device which prepares the gaseous medium. The pressure preparation device is arranged in a stationary manner and supplies the shaping stations with the gaseous medium for the expansion of the plastics material pre-forms by way of at least one connection line. A distribution device is provided which distributes the gaseous medium from the pressure preparation device shaping stations.

Abstract: Described is an apparatus and a method with a plurality of treatment units which are arranged on a carrier rotatable about an axis of rotation and which treat the containers in a pre-set manner, wherein the carrier is driven by at least one drive device and a speed of rotation of the carrier is retarded by at least one mechanical braking device which contacts the carrier at least for a time, and wherein for a retardation of the speed of rotation of the rotatable carrier at least one valve of the braking device is switched in a variable manner by a control device connected in terms of communication to the braking device, in such a way that a flowable medium under pressure is drawn individually from or into a reservoir of the braking device on or from a braking cylinder of the braking device.

Abstract: A method for blow molding containers in blow molds of a device operated with the recovery of air from the blow molds, where operation is accomplished consecutively in a preblow stage with a low pressure and at least two further blow stages with respective higher pressures, and where subsequently, in a recovery phase with several pressure stages, air is fed from the respective blow mold, air from the blow mold is first fed into the volumes allocated to the preblow stage, with priority over a feeding at least into the volume allocated to the pressure stage following the preblow stage. Further, a blow control and a control means for the pressure in the volume, where the blow control has a program section for primarily feeding air first into the volume, and possibly for limiting the pressure in the volume to a multiple of the pressure.

Abstract: A blow molding machine with a stationary and a rotating part, comprising a tempering device for tempering blow molds of the blow molding machine using a medium, and a respective method, characterized in that the tempering device is arranged within the blow molding machine.

Abstract: A blowing machine used to produce containers of correctly temperatured preforms in blowing stations including correctly temperatured blow molds, having functional get-up components such as at least electric servomotors assigned to at least the blowing stations to control and/or monitor secondary functions of functional get-up components during production. In order to bring at least some of said functional get-up components for secondary functions to the correct temperature, an electrically operated, controllable liquid temperature control system is supplied by at least one temperature control device and is integrated into the blowing machine and guided through the functional get-up components.

Abstract: A method and an apparatus for the economical production of containers from thermoplastic material with a blow moulding machine (3) are disclosed. For shaping the containers at least one first pressure channel (21) is provided, supplying a first pressure. Likewise at least one second pressure channel (22) is provided, supplying a second pressure, wherein the first pressure is lower than the second pressure. The air in the first pressure compartment (21) is used for the pre-blowing or for other blowing steps of the containers. The air in the second pressure compartment (22) is used for the final blowing of the containers. The final blown containers are vented into the first pressure compartment (21). A control unit is provided which maintains an essentially constant pressure in the first pressure compartment during the pre-blowing and the venting into the first pressure compartment. A pressure level of the external pressure reservoir (20) can be adjusted accordingly.

Abstract: An apparatus for shaping plastic preforms into plastic containers, including a plurality of blow moulding stations which each have a cavity in which the plastic preforms can be shaped into plastic containers. The blow moulding stations are arranged on a movable carrier and each have a stretching rod which stretches the plastic containers in their longitudinal direction by a movement in a stretching direction. A fluid-actuated drive device is provided for driving the stretching rod in the stretching direction. The apparatus includes a guide cam which is arranged in a stationary manner and by means of which the stretching rod can be moved counter to the stretching direction as a function of a movement of the blow moulding station. At least one portion of the guide cam is adjustable and, for example, by virtue of this adjustment a dependency of the movement of the stretching rod on the movement of the blow moulding station can be varied.

Abstract: A blowing machine used to produce containers of correctly temperatured preforms in blowing stations including correctly temperatured blow molds, having functional get-up components such as at least electric servomotors assigned to at least the blowing stations to control and/or monitor secondary functions of functional get-up components during production. In order to bring at least some of said functional get-up components for secondary functions to the correct temperature, an electrically operated, controllable liquid temperature control system is supplied by at least one temperature control device and is integrated into the blowing machine and guided through the functional get-up components.

Abstract: A method for blow molding containers in blow molds of a device operated with the recovery of air from the blow molds, where operation is accomplished consecutively in a preblow stage with a low pressure and at least two further blow stages with respective higher pressures, and where subsequently, in a recovery phase with several pressure stages, air is fed from the respective blow mold, air from the blow mold is first fed into the volumes allocated to the preblow stage, with priority over a feeding at least into the volume allocated to the pressure stage following the preblow stage. Further, a blow control and a control means for the pressure in the volume, where the blow control has a program section for primarily feeding air first into the volume, and possibly for limiting the pressure in the volume to a multiple of the pressure.

Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.

Abstract: A method and an apparatus for the economical production of containers from thermoplastic material with a blow moulding machine (3) are disclosed. For shaping the containers at least one first pressure channel (21) is provided, supplying a first pressure. Likewise at least one second pressure channel (22) is provided, supplying a second pressure, wherein the first pressure is lower than the second pressure. The air in the first pressure compartment (21) is used for the pre-blowing or for other blowing steps of the containers. The air in the second pressure compartment (22) is used for the final blowing of the containers. The final blown containers are vented into the first pressure compartment (21). A control unit is provided which maintains an essentially constant pressure in the first pressure compartment during the pre-blowing and the venting into the first pressure compartment. A pressure level of the external pressure reservoir (20) can be adjusted accordingly.

Abstract: An apparatus for sorting piece goods may include a receiving surface which can rotate about a predefined rotation axis and is designed to receive the piece goods. The apparatus may include a first guide rail for guiding the piece goods, wherein this guide rail has a gap through which one region of the piece goods passes and by means of which another region of the piece goods is held. The apparatus may include a turning device which pivots the piece goods with respect to a longitudinal direction of the piece goods. The apparatus may include a separating device which separates out some of the sorted piece goods which are not guided in a predefined manner by the first guide rail or by the turning device. The turning device may be arranged upstream of the separating device in the movement direction of the piece goods.

Abstract: A method for controlling and regulating a unit for producing hollow bodies, including a compressor, a blowing machine and a control unit, which controls both the compressor and the blowing machine. A system also provided for returning blast air from the finished blown container to the compressor. Also, a device for producing hollow bodies, with a compressor, a blowing machine and a control system, which for the exchange of data is connected to the blowing machine and to the compressor.

Abstract: A method of producing an antenna structure for an automotive vehicle comprising the steps of providing a substrate element and arranging the antenna structure on one surface of the substrate element.

Abstract: A conveyance device, particularly relating to a shaking pocket star wheel for conveying containers, with a carrier, a reception element and a reception opening for the conveyed material. The reception element is fixed against the force of a spring in a manner so it can be withdrawn and swiveled about an axis of rotation. To simplify the construction of the conveyance device, and to make the design more universal and operationally reliable, a spring is arranged in such a manner that the force is applied substantially at a right angle to the conveyance direction.

Abstract: A cartilage array comprises a plurality of different polynucleotide probe spots stably associated with a solid surface of a carrier, whereby each of said spots is made of a unique polynucleotide that corresponds to one specific cartilage marker gene. Said specific cartilage marker genes preferably are at least in part selected from a group of 467 genes that could be shown to be cartilage related.

Abstract: A reaction chamber assembly comprising a e.g. microscope slide or any other slide or carrier system and an assembly cover is described, wherein said assembly cover comprises at least one port and at least one channel having a first end at the port and a second end at a reaction compartment which reaction compartment together with the e.g. microscope slide forms a reaction chamber with predetermined volume.

Abstract: A method of producing an antenna structure for an automotive vehicle comprising the steps of providing a substrate element and arranging the antenna structure on one surface of the substrate element.

Abstract: A conveyance device, particularly relating to a shaking pocket star wheel for conveying containers, with a carrier, a reception element and a reception opening for the conveyed material. The reception element is fixed against the force of a spring in a manner so it can be withdrawn and swiveled about an axis of rotation. To simplify the construction of the conveyance device, and to make the design more universal and operationally reliable, a spring is arranged in such a manner that the force is applied substantially at a right angle to the conveyance direction.