Patents by Inventor Andrew Jeremy Dunbar

Andrew Jeremy Dunbar has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Bovine milk growth factor
    Publication number: 20030152526
    Abstract: The present invention relates to a novel growth factor from bovine milk, milk products or milk product extracts. The present invention also relates to the use of recombinant DNA technology to isolate, clone and sequence nucleic acids encoding the mature and precursor forms of the growth factor and, in addition, to the use of these nucleic acids in the recombinant production of the growth factor.
    Type: Application
    Filed: January 8, 2003
    Publication date: August 14, 2003
    Applicant: GroPep Pty. Ltd.
    Inventors: Andrew Jeremy Dunbar, Christopher Goddard, David Andrew Belford
  • Mammalian milk growth factor
    Patent number: 6531134
    Abstract: A mammalian milk growth factor (MMGF) having the following amino acid sequence or substantially homologous sequence: DGNSTRSPEDDGLLCGDHAENCPATTTQPKRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFY (SEQ ID NO:2) or a mutant, analogue, derivative or functionally active fragment thereof.
    Type: Grant
    Filed: May 10, 2000
    Date of Patent: March 11, 2003
    Assignee: Gropep Pty Ltd.
    Inventors: Andrew Jeremy Dunbar, Christopher Goddard, David Andrew Belford