Abstract: An electric cooling fan system can include a frame, a first fan, a first electric motor assembly supported by the frame and operably connected to the first fan, a second fan, a second electric motor assembly supported by the frame and operably connected to the second fan, and a liquid cooling path that passes adjacent to both a first stator of the first electric motor assembly and a second stator of the second electric motor assembly such that thermal energy is transferable from the first electric motor assembly and the second electric motor assembly to a liquid coolant present in the liquid cooling path. Other aspects of an electric cooling fan system and associated method of making the same are also disclosed.

Abstract: An electric cooling fan system can include a frame, a first fan, a first electric motor assembly supported by the frame and operably connected to the first fan, a second fan, a second electric motor assembly supported by the frame and operably connected to the second fan, and a liquid cooling path that passes adjacent to both a first stator of the first electric motor assembly and a second stator of the second electric motor assembly such that thermal energy is transferable from the first electric motor assembly and the second electric motor assembly to a liquid coolant present in the liquid cooling path. Other aspects of an electric cooling fan system and associated method of making the same are also disclosed.

Abstract: A spark detector indicates the presence of a spark by analyzing sound waves generated when an electrical spark is produced from an electrical spark generator located on an igniter rod. The spark detector includes an acoustic sensor that is in communication with the igniter rod to determine the time for the spark sound wave to travel through the igniter rod to the acoustic sensor. If a spark is not detected, the spark detector may output a signal indicating at least one of (i) the spark was not detected, (ii) to replace the electrical spark generator immediately, or (iii) replace the electrical spark generator soon such as at the next scheduled maintenance. Furthermore, the spark detector may be calibrated based on current temperature of the igniter rod based upon time of propagation of a pulse sound wave, generated by a pulse-echo generator, to reflect off an end of the igniter rod.

Abstract: A spark detector indicates the presence of a spark by analyzing sound waves generated when an electrical spark is produced from an electrical spark generator located on an igniter rod. The spark detector includes an acoustic sensor that is in communication with the igniter rod to determine the time for the spark sound wave to travel through the igniter rod to the acoustic sensor. If a spark is not detected, the spark detector may output a signal indicating at least one of (i) the spark was not detected, (ii) to replace the electrical spark generator immediately, or (iii) replace the electrical spark generator soon such as at the next scheduled maintenance. Furthermore, the spark detector may be calibrated based on current temperature of the igniter rod based upon time of propagation of a pulse sound wave, generated by a pulse-echo generator, to reflect off an end of the igniter rod.

Abstract: A system and method for identifying and measuring the quantity of leakage from a conduit used in the conveyance of a fluid, such as a hydrocarbon fluid, for example oil, or a gas, such as natural gas. The system includes a measurement device configured to measure a distributed temperature along a length of the conduit. The system further includes a processor configured to calculate a change in volume of the fluid in the conduit for each of a plurality of sections of the length of the conduit based on the distributed temperature. The processor is further configured to calculate a correction factor based on the change in volume of the fluid. The processor is also configured to calculate a corrected mass-balance differential using the correction factor, and compare the corrected mass-balance differential to a predetermined leakage threshold to identify whether a leak exists in the conduit.

Abstract: An optical fiber sensor system and method for monitoring a condition of a linear structure such as a pipeline is provided which is capable of providing continuous monitoring in the event of a break in the sensing optical fiber or fibers. The system includes at least one sensing fiber provided along the length of the linear structure, and first and second interrogation and laser pumping sub-systems disposed at opposite ends of the sensing fiber, each of which includes a reflectometer. The reflectometer of the first interrogation and laser pumping sub-system is connected to one end of the sensing fiber. The reflectometer of the second interrogation and laser pumping sub-system is coupled to either (i) an end of a second sensing fiber provided along the length of the linear structure which is opposite from the one end of the first sensing fiber, or (ii) the opposite end of the first sensing fiber.

Abstract: Apparatus and a method for monitoring of a pipe inspection tool in a pipeline, the apparatus comprising at least one sensor carrier apparatus being locatable along and in close proximity to a pipeline, a plurality of acoustic sensors being locatable on the sensor carrier apparatus, a pipeline inspection tool which is moveable through the pipeline being detectable by means of the acoustic sensors, and the location of the pipeline inspection tool being able to be determined by means of the acoustic sensors.

Abstract: Apparatus and a method for monitoring of a pipe inspection tool in a pipeline, the apparatus comprising at least one sensor carrier apparatus being locatable along and in close proximity to a pipeline, a plurality of acoustic sensors being locatable on the sensor carrier apparatus, a pipeline inspection tool which is moveable through the pipeline being detectable by means of the acoustic sensors, and the location of the pipeline inspection tool being able to be determined by means of the acoustic sensors.

Abstract: A cable for monitoring a tubular structure. The cable comprising a fiber optic bundle arranged for simultaneously sensing a plurality of parameters along a length of the tubular structure that the cable is interfaced with.

Abstract: An intrusion detection system for monitoring a premises includes at least one optical cable that houses at least one optical fiber and extends about the premises. Optical time domain reflectometry (OTDR) means is operably coupled to opposite first and second ends of the at least one optical fiber. The OTDR means includes first signal processing circuitry that analyzes the backscatter signal received via the first end of the at least one optical fiber in order to detect an intrusion of the premises, and second signal processing circuitry that analyzes the backscatter signal received via the second end of the at least one optical fiber in order to detect an intrusion of the premises. The redundancy of intrusions decisions made by the first and second signal processing circuitry can be verified.

Abstract: A cable for monitoring a tubular structure. The cable comprising a fiber optic bundle arranged for simultaneously sensing a plurality of parameters along a length of the tubular structure that the cable is interfaced with.

Abstract: A leak detection system and method is provided for a structure having a first barrier to a first fluid and a second barrier to a second fluid, the first barrier and the second barrier defining a space therebetween. The system includes at least one sensor, such as a fiber optic sensor, placed in the space and configured to detect presence of the first fluid or the second fluid in the space due to a fluid leak in the first barrier or the second barrier. The fiber optic sensor may further be configured to measure one or more characteristics of an acoustic emission caused by the leak, and the system and method may be able to estimate the orifice diameter of the fluid leak based on the measured one or more characteristics, and to calculate a leak rate based on the estimated orifice diameter.

Abstract: A system and method for identifying and measuring the quantity of leakage from a conduit used in the conveyance of a fluid, such as a hydrocarbon fluid, for example oil, or a gas, such as natural gas. The system includes a measurement device configured to measure a distributed temperature along a length of the conduit. The system further includes a processor configured to calculate a change in volume of the fluid in the conduit for each of a plurality of sections of the length of the conduit based on the distributed temperature. The processor is further configured to calculate a correction factor based on the change in volume of the fluid. The processor is also configured to calculate a corrected mass-balance differential using the correction factor, and compare the corrected mass-balance differential to a predetermined leakage threshold to identify whether a leak exists in the conduit.

Abstract: Apparatus and a method for monitoring of a pipe inspection tool in a pipeline, the apparatus comprising at least one sensor carrier apparatus being locatable along and in close proximity to a pipeline, a plurality of acoustic sensors being locatable on the sensor carrier apparatus, a pipeline inspection tool which is moveable through the pipeline being detectable by means of the acoustic sensors, and the location of the pipeline inspection tool being able to be determined by means of the acoustic sensors.

Abstract: An optical fiber sensor system and method for monitoring a condition of a linear structure such as a pipeline is provided which is capable of providing continuous monitoring in the event of a break in the sensing optical fiber or fibers. The system includes at least one sensing fiber provided along the length of the linear structure, and first and second interrogation and laser pumping sub-systems disposed at opposite ends of the sensing fiber, each of which includes a reflectometer. The reflectometer of the first interrogation and laser pumping sub-system is connected to one end of the sensing fiber. The reflectometer of the second interrogation and laser pumping sub-system is coupled to either (i) an end of a second sensing fiber provided along the length of the linear structure which is opposite from the one end of the first sensing fiber, or (ii) the opposite end of the first sensing fiber.

Abstract: A technique facilitates the monitoring of elongate structures. An elongate structure is combined with an optical fiber deployed along the structure. An interrogation system is operatively joined with the optical fiber to input and monitor optical signals to determine any changes in parameters related to the structure.

Abstract: A method of installing a cable for the distributed measurement of a physical parameter, includes providing a cable adapted to measure a physical parameter at a plurality of points along the carrier tube, inserting the cable through a carrier tube, injecting a hardenable fluid into the carrier tube, and hardening the hardenable fluid material to be in a substantially solid state.

Abstract: A leak detection system and method is provided for a structure having a first barrier to a first fluid and a second barrier to a second fluid, the first barrier and the second barrier defining a space therebetween. The system includes at least one sensor, such as a fiber optic sensor, placed in the space and configured to detect presence of the first fluid or the second fluid in the space due to a fluid leak in the first barrier or the second barrier. The fiber optic sensor may further be configured to measure one or more characteristics of an acoustic emission caused by the leak, and the system and method may be able to estimate the orifice diameter of the fluid leak based on the measured one or more characteristics, and to calculate a leak rate based on the estimated orifice diameter.

Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.

Abstract: An intrusion detection system for monitoring a premises includes at least one optical cable that houses at least one optical fiber and extends about the premises. Optical time domain reflectometry (OTDR) means is operably coupled to opposite first and second ends of the at least one optical fiber. The OTDR means includes first signal processing circuitry that analyzes the backscatter signal received via the first end of the at least one optical fiber in order to detect an intrusion of the premises, and second signal processing circuitry that analyzes the backscatter signal received via the second end of the at least one optical fiber in order to detect an intrusion of the premises. The redundancy of intrusions decisions made by the first and second signal processing circuitry can be verified.