Patents by Inventor Birgit Schuh

Birgit Schuh has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20240197844
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: February 28, 2024
    Publication date: June 20, 2024
    Applicant: AFFIRIS CVD GMBH
    Inventors: Sylvia BRUNNER, Gergana GALABOVA, Gabriele WINSAUER, Erika BILCIKOVA, Claudia JUNO, Pola LINZMAYER-HIRT, Birgit SCHUH, Guenther STAFFLER
  • Patent number: 11980657
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: January 11, 2021
    Date of Patent: May 14, 2024
    Assignee: AFFIRIS CVD GMBH
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Publication number: 20210138048
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: January 11, 2021
    Publication date: May 13, 2021
    Applicant: AFFIRIS AG
    Inventors: Sylvia BRUNNER, Gergana GALABOVA, Gabriele WINSAUER, Erika BILCIKOVA, Claudia JUNO, Pola LINZMAYER-HIRT, Birgit SCHUH, Guenther STAFFLER
  • Patent number: 10933123
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: May 21, 2018
    Date of Patent: March 2, 2021
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Publication number: 20180289781
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: May 21, 2018
    Publication date: October 11, 2018
    Applicant: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Patent number: 9999659
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: December 2, 2016
    Date of Patent: June 19, 2018
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Publication number: 20170112908
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: December 2, 2016
    Publication date: April 27, 2017
    Applicant: AFFIRIS AB
    Inventors: Sylvia BRUNNER, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Patent number: 9533030
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Grant
    Filed: August 28, 2013
    Date of Patent: January 3, 2017
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Gergana Galabova, Gabriele Winsauer, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh, Guenther Staffler
  • Publication number: 20150306191
    Abstract: The present invention relates to a vaccine capable to induce the formation of antibodies directed to PCSK9 in vivo.
    Type: Application
    Filed: August 28, 2013
    Publication date: October 29, 2015
    Applicant: AFFIRIS AG
    Inventors: Sylvia BRUNNER, Gergana GALABOVA, Gabriele WINSAUER, Erika BILCIKOVA, Claudia JUNO, Pola LINZMAYER-HIRT, Birgit SCHUH, Guenther STAFFLER
  • Patent number: 9085636
    Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.
    Type: Grant
    Filed: June 11, 2012
    Date of Patent: July 21, 2015
    Assignee: AFFIRIS AG
    Inventors: Sylvia Brunner, Mathias Gebhart, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh
  • Publication number: 20140147456
    Abstract: The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.
    Type: Application
    Filed: June 11, 2012
    Publication date: May 29, 2014
    Applicant: AFFIRIS AG
    Inventors: Sylvia Brunner, Mathias Gebhart, Erika Bilcikova, Claudia Juno, Pola Linzmayer-Hirt, Birgit Schuh