Patents by Inventor Birgitta Henriques Normark

Birgitta Henriques Normark has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Microparticles from as vaccine antigens
    Patent number: 11844829
    Abstract: An isolated Streptococcus pneumoniae membrane vesicle microparticle (MP), wherein said MP comprises: the protein Ply at the level of ?0.070 ?g/?g total protein in the MP; and/or the protein LytA at the level of ?0.070 ?g/?g total protein in the MP; and/or the protein PspC at the level of ?0.130 ?g/?g total protein in the MP; and/or the protein RrgB at the level of ?0.020 ?g/?g total protein in the MP. Compositions comprising such MPs. Uses thereof in particular in immunization, as well as methods of manufacture thereof.
    Type: Grant
    Filed: December 21, 2017
    Date of Patent: December 19, 2023
    Assignee: ZalVac AB
    Inventors: Birgitta Henriques Normark, Mario Codemo, Federico Iovino, Sandra Muschiol, Staffan Normark, Sun Nyunt Wai
  • MANNOSE RECEPTOR-DERIVED PEPTIDES FOR NEUTRALIZING PORE-FORMING TOXINS FOR THERAPEUTIC USES
    Publication number: 20230365647
    Abstract: A polypeptide or peptidomimetic comprising a sequence of at least 7 residues differing by residue substitutions, deletions or insertions numbering 0-2 compared to the sequence: GLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPT-MSWNDINCEHLNNWICQ (SEQ ID NO: 1), for use as a medicament, in particular in pneumococcal disease.
    Type: Application
    Filed: June 29, 2021
    Publication date: November 16, 2023
    Inventors: Birgitta HENRIQUES NORMARK, Karthik SUBRAMANIAM, Georgios SOTIRIOU
  • MICROPARTICLES FROM STREPTOCOCCUS PNEUMONIAE AS VACCINE ANTIGENS
    Publication number: 20230330203
    Abstract: An isolated Streptococcus pneumoniae membrane vesicle microparticle (MP), wherein said MP comprises: the protein Ply at the level of ?0.070 ?g/?g total protein in the MP; and/or the protein LytA at the level of ?0.070 ?g/?g total protein in the MP; and/or the protein PspC at the level of ?0.130 ?g/?g total protein in the MP; and/or the protein RrgB at the level of ?0.020 ?g/?g total protein in the MP. Compositions comprising such MPs. Uses thereof in particular in immunization, as well as methods of manufacture thereof.
    Type: Application
    Filed: June 22, 2023
    Publication date: October 19, 2023
    Inventors: Birgitta Henriques Normark, Mario Codemo, Federico Iovino, Sandra Muschiol, Staffan Normark, Sun Nyunt Wai
  • STREPTOCOCCAL VACCINES
    Publication number: 20230270835
    Abstract: An immunogenic composition comprising bacterial membrane vesicles (MVs) comprising a streptococcal MalX antigen and/or a streptococcal PrsA antigen, characterized in that the MVs do not comprise an immunogenic amount of a streptococcal PspA antigen. The membrane vesicles may be artificial membrane particles. Medical uses of the composition in particular for immunization against pneumococcal disease, and methods of manufacturing the composition.
    Type: Application
    Filed: July 12, 2021
    Publication date: August 31, 2023
    Inventors: Birgitta HENRIQUES NORMARK, Staffan Normark, Federico Iovino, Ana Rita Narciso, Peter Mellroth
  • MICROPARTICLES FROM STREPTOCOCCUS PNEUMONIAE AS VACCINE ANTIGENS
    Publication number: 20190328861
    Abstract: An isolated Streptococcus pneumoniae membrane vesicle microparticle (MP), wherein said MP comprises: the protein Ply at the level of ?0.070 ?g/?g total protein in the MP; and/or the protein LytA at the level of ?0.070 ?g/?g total protein in the MP; and/or the protein PspC at the level of ?0.130 ?g/?g total protein in the MP; and/or the protein RrgB at the level of ?0.020 ?g/?g total protein N in the MP. Compositions comprising such MPs. Uses thereof in particular in immunization, as well as methods of manufacture thereof.
    Type: Application
    Filed: December 21, 2017
    Publication date: October 31, 2019
    Inventors: Birgitta Henriques Normark, Mario Codemo, Federico Iovino, Sandra Muschiol, Staffan Normark, Sun Nyunt