Abstract: Disclosed are new peptides derived from the neurotensin receptor 3 (NTSR3), and to their use, particularly in the treatment of various diseases, especially depression.

Abstract: The present invention relates in particular to polyclonal antibodies directed against peptides, particularly derivatives of the propeptide of sequence QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRW RR (SEQ ID NO 1). The present invention also relates to a method for the production of said antibodies and to a method for assaying said peptides. In addition, the present invention relates to a method for detecting/determining depression in an individual and a method for monitoring the effectiveness of a treatment for depression.

Abstract: Disclosed are new peptides derived from the neurotensin receptor 3 (NTSR3), and to their use, particularly in the treatment of various diseases, especially depression.

Abstract: Compositions, pharmaceutical compositions and biodegradable pharmaceutical compositions containing at least one analog of spadin or at least one analog of a propeptides of spadin or mixtures thereof are described. Methods for treating depression using the analogs of spadin or analogs of propeptides of spadin or mixtures thereof, as well as methods for blocking TREK-1 channel activity are also disclosed.

Abstract: Compositions, pharmaceutical compositions and biodegradable pharmaceutical compositions containing at least one analog of spadin or at least one analog of a propeptides of spadin or mixtures thereof are described. Methods for treating depression using the analogs of spadin or analogs of propeptides of spadin or mixtures thereof, as well as methods for blocking TREK-1 channel activity are also disclosed.

Abstract: The present invention relates to the use of one or more Neuroaid2 components to activate KATP channels and in the treatment of various diseases and disorders. The one or more Neuroaid2 components are selected from the group consisting of: Salviae Miltiorrhizae, Prunus persica; Polygalae; acori tatarinowii; Astragali; Paeoniae Rubra; Chuanxiong; Carthamus tinctorius; and angelicae sinensis.

Abstract: A method of diagnosing depression in a subject, comprising analyzing a biological sample from a subject in need of diagnosis of depression for the expression of spadin, detecting and measuring the amount of spadin in the sample, and diagnosing depression in the subject if an increase or a decrease in spadin expression in the biological sample is detected compared to a control, is described as are methods for monitoring treatment, remission and the course of the disease. Related kits are also described. Also described is a method for identifying candidate compounds for treating depression.

Abstract: The invention relates to a peptide derived from neurotensin receptor 3 (NTSR3), and to the use thereof in the treatment of psychiatric diseases. The present invention particularly relates to the use of this peptide for producing a drug, such as an antidepressant. The peptide of the invention is characterized in that the sequence thereof is the attached SEQ ID No. 2. The present invention can be used in the fields of the pharmaceutical industry and particularly in the field of drug development for treating psychiatric diseases. The present invention can also be used in the development of a novel antidepressant. It can also be used for example, in the treatment of pain and inflammations.

Abstract: The invention relates to a peptide derived from neurotensin receptor 3 (NTSR3), and to the use thereof in the treatment of psychiatric diseases. The present invention particularly relates to the use of this peptide for producing a drug, such as an antidepressant. The peptide of the invention is characterized in that the sequence thereof is the attached SEQ ID No. 2. The present invention can be used in the fields of the pharmaceutical industry and particularly in the field of drug development for treating psychiatric diseases. The present invention can also be used in the development of a novel antidepressant. It can also be used for example, in the treatment of pain and inflammations.

Abstract: The present invention pertains to a method for the reduction of glutamate neurotoxicity in pathophysiology of spinal cord injury induced by aortic cross-clamping. The reduction is achieved by the administration of riluzole to a patient, in an amount effective to reduce glutamate neurotoxicity, contemporaneously with aortic cross-clamping. Preferably, the riluzole is administered both prior to and following the aortic cross-clamping. The method is also applicable to reduce the spinal cord injury resulting from ischemia, and for reducing the effects of ischemia on neuronal tissues.