Abstract: Imaging agents for magnetic resonance imaging are disclosed. Methods of monitoring angiogenesis and the growth and remission of tumor tissue are also disclosed. Methods of monitoring blood clot formation and dissolution are additionally disclosed. Methods of monitoring wound healing are further disclosed. A kit for obtaining an image of a biological structure is further disclosed.

Abstract: Imaging agents for magnetic resonance imaging are disclosed. Methods of monitoring angiogenesis and the growth and remission of tumor tissue are also disclosed. Methods of monitoring blood clot formation and dissolution are additionally disclosed. Methods of monitoring wound healing are further disclosed. A kit for obtaining an image of a biological structure is further disclosed.

Abstract: A chamber for in vivo delivery of an active agent, the chamber including a housing having at least two porous surfaces, the at least two porous surfaces disposed on substantially opposite sides of the housing from each other; an internal void space within the housing; and a matrix composition comprising an active agent, the matrix composition disposed within the internal void space. Therapeutic and screening methods employing the chamber are also disclosed, including methods for in vivo screening of angiogenesis and/or tumor growth modulating agents.

Abstract: Imaging agents for magnetic resonance imaging are disclosed. Methods of monitoring angiogenesis and the growth and remission of tumor tissue are also disclosed. Methods of monitoring blood clot formation and dissolution are additionally disclosed. Methods of monitoring wound healing are further disclosed. A kit for obtaining an image of a biological structure is further disclosed.

Abstract: Fibrin binding peptides disclosed include (a) peptides having the amino acid sequence of a human Blood Coagulation Factor XIIIA fragment (i.e., NKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDR SVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFY GEVNDIKTRSWSYGQF-R', where R, is --CONH.sub.2 or --NH.sub.2); (b) peptides which are fragments of the foregoing Factor XIIIA fragment and which retain the capability thereof of binding to fibrin; and (c) peptides which bind to fibrin, which have the amino acid sequence of any of the foregoing peptides, and which have additional amino acid residues attached to the N-terminal end and/or the C-terminal end thereof.The peptides are useful for localizing blood clots in vivo, inhibiting fibrin stabilization, and promoting thrombolysis.