Patents by Inventor Christopher Goddard

Christopher Goddard has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Material Handling Machine
    Publication number: 20240133149
    Abstract: A trailer towable compact telehandler having an operator cab with an internal width greater than 700 mm and a curbside weight less than 2950 kg. Also included is a telehandler having a side-mounted engine which extends through a side wall of the chassis and under a lifting arm of the telehandler. Also included is a compact tool carrier having a reduced fore-aft dimension between an attachment plane and a principal pivot member.
    Type: Application
    Filed: October 19, 2023
    Publication date: April 25, 2024
    Applicant: J. C. Bamford Excavators Limited
    Inventors: Richard Brindle, Paul Walsham, Jack Nash, Colin Goddard, Robin Scotchford, David Craig Panni, Michael Boyd Richardson, Paula Langley, Thomas Pritchard, Christopher David Price, Jonathan Kenred Bailey, Sam de Berry
  • Metalloproteinase inhibitors
    Publication number: 20050250693
    Abstract: The present invention provides inhibitors of metalloprotineases that may be extracted from lactational secretions such as milk and colostrum. The inhibitors have use in the treatment of a range of diseases such as disorders of the gastrointestinal tract, cardiovascular conditions and wound healing. Methods for purifiying the inhibitors are also disclosed.
    Type: Application
    Filed: November 30, 2004
    Publication date: November 10, 2005
    Inventors: Christopher Goddard, Andrew Dunbar, Matthew Chong
  • Bovine milk growth factor
    Publication number: 20030152526
    Abstract: The present invention relates to a novel growth factor from bovine milk, milk products or milk product extracts. The present invention also relates to the use of recombinant DNA technology to isolate, clone and sequence nucleic acids encoding the mature and precursor forms of the growth factor and, in addition, to the use of these nucleic acids in the recombinant production of the growth factor.
    Type: Application
    Filed: January 8, 2003
    Publication date: August 14, 2003
    Applicant: GroPep Pty. Ltd.
    Inventors: Andrew Jeremy Dunbar, Christopher Goddard, David Andrew Belford
  • Mammalian milk growth factor
    Patent number: 6531134
    Abstract: A mammalian milk growth factor (MMGF) having the following amino acid sequence or substantially homologous sequence: DGNSTRSPEDDGLLCGDHAENCPATTTQPKRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFY (SEQ ID NO:2) or a mutant, analogue, derivative or functionally active fragment thereof.
    Type: Grant
    Filed: May 10, 2000
    Date of Patent: March 11, 2003
    Assignee: Gropep Pty Ltd.
    Inventors: Andrew Jeremy Dunbar, Christopher Goddard, David Andrew Belford