Patents by Inventor Claude Vincent

Claude Vincent has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20140287057
    Abstract: A dietary product for preventing cardiometabolic risk in humans, in particular for reducing visceral fat and deep subcutaneous fat, includes in particular a mixture of: a whey hydrolysate having a molecular weight of between 200 and 10,000 daltons, an isolate and/or concentrate of whey, and calcium caseinate.
    Type: Application
    Filed: October 25, 2012
    Publication date: September 25, 2014
    Inventor: Claude Vincent
  • Publication number: 20100160219
    Abstract: The invention concerns a polypeptide corresponding to amino acids 26 to 75 of the sequence of GRA5-RH protein of SEQ ID No 1: MASVKRVWAVMIVNVLALIFVGVAGSTRDVGSGGDDSEGARGRE QQQVQQHEQNEDRSLFERGRAAVT-GHPVRTAVGLAAAWAWSLL RLLKRRRRRAIQEESKESATAEEEEVAEEE, its variants acting on dendritic cell migration, homologues acting on dendritic cell migration, and fragments thereof acting on dendritic cell migration, as well as the pharmaceutical compositions thereof comprising such polypeptides and their use for making a medicine for preventing or treating skin and mucous membrane conditions involving dendritic cells or Langerhans cells.
    Type: Application
    Filed: April 27, 2007
    Publication date: June 24, 2010
    Inventors: Florence Persat, Claude Vincent, Marie-France Cesbron-Delauw
  • Publication number: 20080076963
    Abstract: The surgical kit comprises at least one elongate strip for supporting the urethra of a patient, the strip comprising a knit of yarns forming empty spaces between one another, at least in the longitudinal middle portion of the strip that is to extend transversely under the urethra when the strip is implanted, said knit comprising both reinforcement constituted by longitudinal chains and an intermediate trellis transversely interconnecting the chains. In order to guarantee light obstructive support of the urethra, the treatment kit further comprises suture means adapted to be connected to the chains of the knit by being passed through the empty spaces so as to join the middle portion of the strip with the anatomical tissue under the urethra at least two connection spots in alignment in a direction that is substantially perpendicular to the longitudinal direction of the strip.
    Type: Application
    Filed: August 3, 2007
    Publication date: March 27, 2008
    Applicant: CL MEDICAL
    Inventor: Jean-Claude Vincent Goria
  • Patent number: 4954261
    Abstract: Method and device for the selective extraction of compounds, particularly biochemical compounds having a high added value, from a complex solution. The method makes use of a monoenzyme reactive membrane system (3, 4, 5, 6) in a liquid medium, at the interfaces of which an electrochemical potential gradient of one of the reagents creates asymmetrical conditions which force the reversible reaction catalyzed by the reactive membrane system to operate in opposite directions on either side of said system, the passage of the compound to be extracted from one side to the other being favored by the presence on both faces of said system of barriers (5) which confine a compound other than the compound to be extracted. Device for implementing such method. Application to the extraction of compounds which are interesting from a biochemical point of view by concentration and accumulation on one side of the membrane system.
    Type: Grant
    Filed: January 30, 1989
    Date of Patent: September 4, 1990
    Assignee: Centre National de la Recerche Scientifique - Cnrs
    Inventors: Stephane Alexandre, Michel Thellier, Jean-Claude Vincent
  • Patent number: 4215151
    Abstract: The invention concerns a process and a device for roasting an agro-food product in the form of grains.The process consists of fluidizing an auxiliary body in the form of fine solid particles in an enclosure 1, and putting the grains of the product to be roasted in flotation in the fluidized bed of particles of which the temperature is adapted to roasting, to generate the roasting by the effect of the shocks of the fine particles of the auxiliary body with the grains of the product.The invention can be applied particularly for the roasting of grains of a product such as coffee, cocoa, etc.
    Type: Grant
    Filed: May 11, 1978
    Date of Patent: July 29, 1980
    Assignee: Agence Nationale de Valorisation de la Recherche (ANVAR)
    Inventors: Gilbert M. Rios, Henri Gibert, Jean Crouzet, Jean-Claude Vincent