Patents by Inventor Colin Michael Edge

Colin Michael Edge has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • LRRK2 inhibitors for the treatment of Parkinson's disease
    Patent number: 10618901
    Abstract: The present invention relates to novel compounds that inhibit LRRK2 kinase activity, processes for their preparation, to compositions containing them and to their use in the treatment of or prevention of diseases characterized by LRRK2 kinase activity, for example Parkinson's disease, Alzheimer's disease and amyotrophic lateral sclerosis (ALS).
    Type: Grant
    Filed: August 2, 2018
    Date of Patent: April 14, 2020
    Assignee: GLAXOSMITHKLINE INTELLECTUAL PROPERTY DEVELOPMENT LIMITED
    Inventors: Xiao Ding, Qian Liu, Yingxia Sang, Luigi Piero Stasi, Zehong Wan, Baowei Zhao, Colin Michael Edge
  • COMPOUNDS
    Publication number: 20180354956
    Abstract: The present invention relates to novel compounds that inhibit LRRK2 kinase activity, processes for their preparation, to compositions containing them and to their use in the treatment of or prevention of diseases characterized by LRRK2 kinase activity, for example Parkinson's disease, Alzheimer's disease and amyotrophic lateral sclerosis (ALS).
    Type: Application
    Filed: August 2, 2018
    Publication date: December 13, 2018
    Inventors: Xiao Ding, Qian Liu, Yingxia Sang, Luigi Piero Stasi, Zehong Wan, Baowei Zhao, Colin Michael Edge
  • Compounds as LRRK2 kinase inhibitors
    Patent number: 10087186
    Abstract: The present invention relates to novel compounds that inhibit LRRK2 kinase activity, processes for their preparation, to compositions containing them and to their use in the treatment of or prevention of diseases characterized by LRRK2 kinase activity, for example Parkinson's disease, Alzheimer's disease and amyotrophic lateral sclerosis (ALS).
    Type: Grant
    Filed: January 28, 2015
    Date of Patent: October 2, 2018
    Assignee: GlaxoSmithKline Intellectual Property Development Limited
    Inventors: Xiao Ding, Luigi Piero Stasi, Zehong Wan, Colin Michael Edge
  • Compounds
    Patent number: 9815841
    Abstract: The present invention relates to novel compounds that inhibit LRRK2 kinase activity, processes for their preparation, to compositions containing them and to their use in the treatment of or prevention of diseases characterized by LRRK2 kinase activity, for example Parkinson's disease, Alzheimer's disease and amyotrophic lateral sclerosis (ALS).
    Type: Grant
    Filed: January 28, 2015
    Date of Patent: November 14, 2017
    Assignee: GlaxoSmithKline Intellectual Property Development Limited
    Inventors: Xiao Ding, Qian Liu, Kai Long, Yingxia Sang, Luigi Piero Stasi, Zehong Wan, Qiongfeng Xu, Colin Michael Edge
  • COMPOUNDS
    Publication number: 20170022204
    Abstract: The present invention relates to novel compounds that inhibit LRRK2 kinase activity, processes for their preparation, to compositions containing them and to their use in the treatment of or prevention of diseases characterized by LRRK2 kinase activity, for example Parkinson's disease, Alzheimer's disease and amyotrophic lateral sclerosis (ALS).
    Type: Application
    Filed: January 28, 2015
    Publication date: January 26, 2017
    Inventors: Xiao DING, Qian LIU, Kai LONG, Yingxia SANG, Luigi Piero STASI, Zehong WAN, Qiongfeng XU, Colin Michael EDGE
  • COMPOUNDS
    Publication number: 20170015668
    Abstract: The present invention relates to novel compounds that inhibit LRRK2 kinase activity, processes for their preparation, to compositions containing them and to their use in the treatment of or prevention of diseases characterized by LRRK2 kinase activity, for example Parkinson's disease, Alzheimer's disease and amyotrophic lateral sclerosis (ALS).
    Type: Application
    Filed: January 28, 2015
    Publication date: January 19, 2017
    Inventors: Xiao DING, Qian LIU, Yingxia SANG, Luigi Piero STASI, Zehong WAN, Baowei ZHAO, Colin Michael EDGE
  • Fragments of CR1 and their use
    Patent number: 6797806
    Abstract: A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multimeric and chimeric derivatives, pharmaceutiocal compositions containing them and their use in therapy.
    Type: Grant
    Filed: December 1, 1998
    Date of Patent: September 28, 2004
    Assignee: AdProTech Limited
    Inventors: Danuta Ewa Irena Mossakowska, Colin Michael Edge, Richard Anthony Godwin Smith
  • FRAGMENTS OF CR1 AND THEIR USE
    Publication number: 20020142372
    Abstract: A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVIFELVGEPSIYCTSNDDQVGIWSG, of 6 to 23 amino acids in lengtlh and comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multinieric and chimiiaeric derivatives, pharmaceutical compositions containing them and theil rise in therapy.
    Type: Application
    Filed: December 1, 1998
    Publication date: October 3, 2002
    Inventors: DANUTA EWA IRENA MOSSAKOWSKA, COLIN MICHAEL EDGE, RICHARD ANTHONY GODWIN SMITH