Abstract: The invention relates to nucleic acid molecules encoding (poly)peptides having LPI (Lectin Pathway Inhibitor) activity, to recombinant vectors harboring such molecules, and the host cells carrying the vectors. The invention further relates to methods for preparing recombinant (poly)peptides having LPI activity and to the use of such recombinant (poly)peptides having LPI activity for diagnosis, prophylaxis and treatment, such as the treatment of inflammation reactions. In addition the invention provides therapeutic and diagnostic compositions comprising as the active ingredient the (poly)peptide having LPI activity.

Abstract: The present invention relates to Staphylococcal superantigen-like protein 5 (SSL5) or homologues or derivatives thereof for use in medicine, in particular for use in the treatment of indications involving an excessive recruitment of leukocytes, such as stroke, perfusion/ischemia, transplant rejection, rheumatoid arthritis. The invention further relates to a pharmaceutical composition comprising SSL5 and a suitable excipient. The invention also provides the use of SSL5 for the preparation of a medicament for treatment of indications involving an excessive recruitment of leukocytes to a site of tissue damage, such as stroke, reperfusion/ischemic, transplant rejection and rheumatoid arthritis.

Abstract: The present invention relates to a FPLR-1 inhibitor selected from the group consisting of FLIPr having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGG FLIPr-like having the amino acid sequence MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERADKLIKEADEKNEHYKGKTVEDLYVIAKKMGKGNTIAVVKIKDGGK fragments of a) or b) having FPLR-1 inhibitory activity; homologues of a), b) or c) having FPLR-1 inhibitory activity; or derivatives of a), b), c) or d) having FPLR-1 inhibitory activity.

Abstract: The invention relates to nucleic acid molecules encoding (poly)peptides having LPI (Lectin Pathway Inhibitor) activity, to recombinant vectors harboring such molecules, and the host cells carrying the vectors. The invention further relates to methods for preparing recombinant (poly)peptides having LPI activity and to the use of such recombinant (poly)peptides having LPI activity for diagnosis, prophylaxis and treatment, such as the treatment of inflammation reactions. In addition the invention provides therapeutic and diagnostic compositions comprising as the active ingredient the (poly)peptide having LPI activity.

Abstract: The present invention relates to a new protein of the bacteria Straphylococcus aureus with immunomodulating properties. The invention further relates to the manufacture of a therapeutic composition as general inflammation inhibitor and for the treatment of AIDS, and also the use of antibodies against CHIPS for the treatment of Staphylococcus infections.

Abstract: The invention relates to nucleic acid molecules encoding (poly)peptides having chemotaxis inhibiting (poly)peptides CHIPS activity, to recombinant vectors harboring such molecules, and the host cells carrying the vectors. The invention further relates to methods for preparing recombinant (poly)peptides having CHIPS activity and to the use of such recombinant (poly)peptides having CHIPS activity for diagnosis, prophylaxis and treatment, such as the treatment of inflammation reactions and HIV. In addition, the invention provides therapeutic and diagnostic compositions comprising as the active ingredient the (poly)peptide having CHIPS activity.

Abstract: The present invention relates to a new protein of the bacteria Straphylococcus aureus with immunomodulating properties. The invention further relates to the manufacture of a therapeutic composition as general inflammation inhibitor and for the treatment of AIDS, and also the use of antibodies against CHIPS for the treatment of Staphylococcus infections.

Abstract: The invention relates to nucleic acid molecules encoding (poly)peptides having CHIPS activity, to recombinant vectors harboring such molecules, and the host cells carrying the vectors. The invention further relates to methods for preparing recombinant (poly)peptides having CHIPS activity and to the use of such recombinant (poly)peptides having CHIPS activity for diagnosis, prophylaxis and treatment, such as the treatment of inflammation reactions and HIV. In addition the invention provides therapeutic and diagnostic compositions comprising as the active ingredient the (poly)peptide having CHIPS activity.

Abstract: The invention relates to the new use of Serum Amyloid P component (SAP) and/or endotoxin-binding fragments thereof for the preparation of a pharmaceutical composition for neutralizing lipopolysaccharide and particularly for the treatment of sepsis. The invention further relates to a diagnostic method for demonstrating the presence of endotoxin in blood or blood fractions, such as serum or plasma.