Abstract: An optic assembly for an automotive rearview mirror including a reflector having facets for managing light from a light source in the optic assembly and for lighting an illuminated feature in the rearview mirror. The reflector is selectively reflective, such that not all surface areas within the reflector are reflective. A method for manufacturing the reflector includes a process for selectively metallizing the reflector.

Abstract: An electromagnetic radiation assembly is described and which includes a reflector having discrete first and second surfaces; a first electromagnetic radiation emitter positioned adjacent to the first surface; and a second electromagnetic radiation emitter positioned adjacent to the second surface, and wherein, when energized, the first and second electromagnetic radiation emitters emit visibly discernible electromagnetic radiation which is reflected by the reflector in a fashion so as to be visible at locations forward of the first surface.

Abstract: An electromagnetic radiation assembly is described and which includes a reflector having discrete first and second surfaces; a first electromagnetic radiation emitter positioned adjacent to the first surface; and a second electromagnetic radiation emitter positioned adjacent to the second surface, and wherein, when energized, the first and second electromagnetic radiation emitters emit visibly discernible electromagnetic radiation which is reflected by the reflector in a fashion so as to be visible at locations forward of the first surface.

Abstract: An electromagnetic radiation assembly is described and which includes a reflector having discrete first and second surfaces; a first electromagnetic radiation emitter positioned adjacent to the first surface; and a second electromagnetic radiation emitter positioned adjacent to the second surface, and wherein, when energized, the first and second electromagnetic radiation emitters emit visibly discernible electromagnetic radiation which is reflected by the reflector in a fashion so as to be visible at locations forward of the first surface.

Abstract: A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and an acceptable vehicle.

Abstract: A signaling assembly is described and which includes a semitransparent mirror; a reflector housing, defining a cavity, and which is juxtaposed relative to the semitransparent mirror; and an electromagnetic radiation emitter positioned in the reflector housing and which, when energized, predominantly emits visibly discernable electromagnetic radiation which travels substantially, laterally, outwardly relative to the emitter, and which is reflected by the reflector housing so as to subsequently pass through the semitransparent mirror to form a visibly discernable signal.

Abstract: A signaling assembly is described which includes a semitransparent mirror, an opaque layer attached to the semitransparent mirror, a reflector member positioned within an aperture defined by the opaque layer; a circuit board defining an aperture through which visible light can pass, and which is positioned in spaced relation relative to the semitransparent mirror; and an electromagnetic radiation emitter mounted on the rear surface of the circuit board and which emits visible light which is passed by the circuit board and an opaque layer and which is reflected from the reflector member so as to form a visibly discernable signal which is passed by the semitransparent mirror.

Abstract: An electromagnetic radiation assembly is described and which includes a reflector having discrete first and second surfaces; a first electromagnetic radiation emitter positioned adjacent to the first surface; and a second electromagnetic radiation emitter positioned adjacent to the second surface, and wherein, when energized, the first and second electromagnetic radiation emitters emit visibly discernible electromagnetic radiation which is reflected by the reflector in a fashion so as to be visible at locations forward of the first surface.

Abstract: A signal assembly is described and which includes a mirror which is operable to reflect, and pass electromagnetic radiation; a circuit substrate having a plurality of electrically conductive pathways which is borne on same; a light emitting device borne by the circuit substrate, and which, when energized, emits visibly discernable electromagnetic radiation which passes by each of the circuit substrate and the mirror; and an electrically actuated assembly, such as a heater, which may be electrically coupled with a source of electricity by way of the circuit substrate.

Abstract: An electromagnetic radiation assembly is disclosed and which includes a circuit substrate having a first portion and a flexible second portion, and wherein the circuit substrate defines at least one electrical pathway; a first electromagnetic radiation emitter is electrically coupled to the electrical pathway and located on the first portion of the circuit substrate; and a second electromagnetic radiation emitter is electrically coupled to the electrical pathway and located on the second portion of the circuit substrate.

Abstract: An electromagnetic radiation assembly is described and which includes, a supporting substrate having a region through which visibly discernable electromagnetic radiation forming a signal may pass; first and second electromagnetic radiation emitters are provided and which are positioned adjacent to one of the surfaces defined by the substrate, and which, when energized, emit electromagnetic radiation; and a single reflector is disposed in eccentric reflecting relation relative to the first and second electromagnetic radiation emitters, and wherein emitted electromagnetic radiation is reflected by the single reflector and passes through the supporting substrate region which passes electromagnetic radiation, in different directions.

Abstract: The illuminating sleeve has at least one fastening tongue which is extended towards its front collar portion, so as to pass through the aperture in the fixed wall to which the illuminating sleeve is fastened.

Abstract: The illuminating sleeve includes a rear face which is covered by an opaque mask.

Abstract: The invention relates to a device for controlling the pressure within a pulsed column. The device comprises first and second dipping tubes respectively issuing into the column at the level of points P.sub.1 and P.sub.2, means for introducing a gas into each of the tubes and for bubbling it in the column liquid and means for determining the pressure difference between said tubes. The first and second dipping tubes respectively issue into the column via cavities C.sub.1 and C.sub.2 having dimensions such that during pressure variations due to pulsation, the gas-liquid interface is always located in each of said cavities and the variations in the gas-liquid interface level in each cavity are inversely proportional to the densities of the liquids present in each cavity. Thus, it is possible to eliminate the prejudicial influence of pressure variations within the liquid due to pulsation. The device can in particular be used for measuring the interface level in the decanter.