Abstract: Systems and methods for generating and displaying a non-time bound content channel in a time-bound grid is provided. The system comprises receiving content data representing non-time bound content to be displayed in the time bound grid. The system generates the time bound grid, by creating, based on the content data, a non-time bound content channel. The non-time bound content channel displays one or more content objects representing the non-time bound content in the time bound grid. The system incorporates the non-time bound content channel with a plurality of time bound channels in the time bound grid. The system then causes display of the generated time bound grid on a viewing device of a user.

Abstract: A metal matrix composite to high tolerate wear as a property has been produced by infiltration casting of a Fe Alloy and a spinel ceramic by using a material design for i) metal transport phenomena conditions, ii) predefined wetting and capillarity and iii) processing child insert/mother casting methodology to produce a final casting in shape and form to meet the needs of a mining end user.

Abstract: A golf swing training device for improving the accuracy, club head speed and power of a user's swing can be customized to fit the various abilities and sizes of individual golfers. The device guides a user through the proper swing and by repeating the proper swing, the user can enhance his or her muscle memory. The golf swing training device includes a shuttle moveably mounted on an adjustably supported ring and a club moveably supported by the shuttle.

Abstract: A golf swing training device for improving the accuracy, club head speed and power of a user's swing can be customized to fit the various abilities and sizes of individual golfers. The device guides a user through the proper swing and by repeating the proper swing, the user can enhance his or her muscle memory. The golf swing training device includes a shuttle moveably mounted on an adjustably supported ring and a club moveably supported by the shuttle.

Abstract: A method of aligning implant components includes placing a first implant component in bone, followed by: coupling a first intermediate member to the first implant component; coupling a first alignment member to the first intermediate member; rotating the members as a unit to place the first intermediate member in an alignment position; removing the first alignment member from the first intermediate member; coupling a second alignment member to a second intermediate member; coupling the second intermediate member to the first intermediate member and rotating the second alignment member and the second intermediate member as a unit relative to the first intermediate member to provide a desired orientation of the second intermediate member. An alignment system for aligning first and second members includes a first alignment member having an offset channel dimensioned to receive the first member, and a second alignment member having a channel dimensioned to receive the second member.

Abstract: The subject matter disclosed herein relates to temperature monitoring devices, and more specifically to surface temperature monitoring devices (e.g., surface temperature loggers, surface temperature sensors, surface thermal probes). In an embodiment, a system includes a temperature monitoring device configured to measure a temperature of a surface. The temperature monitoring device includes a housing and a thermal sensor disposed in the housing. The temperature monitoring device also includes a thermal pad disposed on a measurement face of the housing, wherein the thermal pad is configured to provide a high-thermal conductivity path between the surface and the temperature monitoring device.

Abstract: A pouch has an elongate closure mechanism adapted to provide vacuum retention within an interior of the pouch over an extended period of time when sealed. The closure mechanism includes a first pair of interlocking members that resealably mate together, a second pair of interlocking members that resealably mate together, and a pair of sealing members that form an air tight seal separate from the interlocking members disposed between the first and second pairs of interlocking members. The closure members are connected with opposing panels of the pouch in a manner designed to provide differential opening and closing forces. The pouch may include a check valve and air evacuation channels to aid in evacuating air from the interior.

Abstract: A method of aligning implant components includes placing a first implant component in bone, followed by: coupling a first intermediate member to the first implant component; coupling a first alignment member to the first intermediate member; rotating the members as a unit to place the first intermediate member in an alignment position; removing the first alignment member from the first intermediate member; coupling a second alignment member to a second intermediate member; coupling the second intermediate member to the first intermediate member and rotating the second alignment member and the second intermediate member as a unit relative to the first intermediate member to provide a desired orientation of the second intermediate member. An alignment system for aligning first and second members includes a first alignment member having an offset channel dimensioned to receive the first member, and a second alignment member having a channel dimensioned to receive the second member.

Abstract: Electronic publication systems are disclosed that enable the analysis and publication of layout files, which contain an analysis strategy and embedded raw data. The published layout files can be accessed by reader applications that are able to read the layout files and modify the analysis strategy within the layout file using the embedded raw data. In many embodiments, the reader applications are unable to access the embedded raw data. In several embodiments, the reader applications prevent the saving or printing of layout files.

Abstract: A pouch has an elongate closure mechanism adapted to provide vacuum retention within an interior of the pouch over an extended period of time when sealed. The closure mechanism includes a first pair of interlocking members that resealably mate together, a second pair of interlocking members that resealably mate together, and a pair of sealing members that form an air tight seal separate from the interlocking members disposed between the first and second pairs of interlocking members. The closure members are connected with opposing panels of the pouch in a manner designed to provide differential opening and closing forces. The pouch may include a check valve and air evacuation channels to aid in evacuating air from the interior.

Abstract: A pouch has an elongate closure mechanism adapted to provide vacuum retention within an interior of the pouch over an extended period of time when sealed. The closure mechanism includes a first pair of interlocking members that resealably mate together, a second pair of interlocking members that resealably mate together, and a pair of sealing members that form an air tight seal separate from the interlocking members disposed between the first and second pairs of interlocking members. The closure members are connected with opposing panels of the pouch in a manner designed to provide differential opening and closing forces. The pouch may include a check valve and air evacuation channels to aid in evacuating air from the interior.

Abstract: A collapsible storage device includes a collapsible container and a lid for the container. The container includes a plurality of resilient wall panels and a hinge portion connecting each adjacent pair of wall panels. The container may be foldably converted between a substantially flat collapsed position and a substantially rectangular prismatic expanded position by articulating the wall panels about the flexible hinges. At least one of the hinge portions is arched to latch the container in the expanded position. The lid may be used to cover the container in the expanded position and receive the container in the collapsed position.

Abstract: Electronic publication systems are disclosed that enable the analysis and publication of layout files, which contain an analysis strategy and embedded raw data. The published layout files can be accessed by reader applications that are able to read the layout files and modify the analysis strategy within the layout file using the embedded raw data. In many embodiments, the reader applications are unable to access the embedded raw data. In several embodiments, the reader applications prevent the saving or printing of layout files. One embodiment of the invention includes a publication computer connected to a network, a user computer connected to the network and the publication computer is configured to generate a file including an analysis strategy based on the raw data and in which the raw data is embedded.

Abstract: A pouch has an elongate closure mechanism adapted to provide vacuum retention within an interior of the pouch over an extended period of time when sealed. The closure mechanism includes a first pair of interlocking members that resealably mate together, a second pair of interlocking members that resealably mate together, and a pair of sealing members that form an air tight seal separate from the interlocking members disposed between the first and second pairs of interlocking members. The closure members are connected with opposing panels of the pouch in a manner designed to provide differential opening and closing forces. The pouch may include a check valve and air evacuation channels to aid in evacuating air from the interior.

Abstract: Temporarily increasing a credit limit of the credit account to accommodate a purchase by a buyer for goods and/or services from a merchant. An account management module can receive a request to increase the credit limit via an interface. The request can include information regarding the purchase and information regarding the credit limit increase, including an amount by which to increase the credit limit. The request also can include rules for decreasing the credit limit at the end of the credit limit increase term. The account management module can process the credit limit increase and decrease, in accordance with the request. The account management module also can transmit an email to the merchant with credit account information needed to process the purchase. For example, the email can include a link to a web site at which the merchant can obtain the credit account information upon successful completion of an authentication procedure.

Abstract: Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

Abstract: This invention relates to peptides directing a CD4 related T helper cell response wherein the peptides may be used as an adjuvant provided with an antigen or as an immunomodulatory agent without an antigen and compositions comprising modification of a fifteen-mer peptide sequence from the MHC II? chain at positions 135-149 known as Peptide G or a derivative of derG or other derivatives wherein the derivatives enhance the immune response of antigens and methods for treating cancer, autoimmune disease, transplant conditions, infectious conditions or allergies caused by foreign eukaryotic organisms, and infectious conditions or allergies caused by prokaryotic organisms or nonliving agents such as viruses, phages and prions with polypeptides.

Abstract: The invention is related to peptide constructs, i.e.

Abstract: A collapsible storage device includes a collapsible container and a lid for the container. The container includes a plurality of resilient wall panels and a hinge portion connecting each adjacent pair of wall panels. The container may be foldably converted between a substantially flat collapsed position and a substantially rectangular prismatic expanded position by articulating the wall panels about the flexible hinges. At least one of the hinge portions is arched to latch the container in the expanded position. The lid may be used to cover the container in the expanded position and receive the container in the collapsed position.

Abstract: This invention relates to peptides directing a CD4 related T helper cell response wherein the peptides may be used as an adjuvant provided with an antigen or as an immunomodulatory agent without an antigen and compositions comprising modification of a fifteen-mer peptide sequence from the MHC II? chain at positions 135-149 known as Peptide G or a derivative of derG or other derivatives wherein the derivatives enhance the immune response of antigens compositions useful as a pharmaceutical, adjuvant, immunostimulant or immunomodulator to activate the immune system wherein the compositions may also be peptides, non-peptide mimetics or organic molecules selected from aliphatics, carbohydrates, heterocyclics, aromatics or mixtures thereof.