Patents by Inventor Daniele Mathieu

Daniele Mathieu has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation
    Publication number: 20070161553
    Abstract: A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and an acceptable vehicle.
    Type: Application
    Filed: February 2, 2005
    Publication date: July 12, 2007
    Applicant: SYNT:EM
    Inventors: Daniele Mathieu, Jamal Temsamani, Michel Kaczorek