Patents by Inventor David M. Underhill

David M. Underhill has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • DIAGNOSTIC TESTING USING MICROBIAL BIOMARKERS TO CLASSIFY PELVIC AND BLADDER PAIN
    Publication number: 20220145372
    Abstract: The invention describes methods for a method of detecting levels of one or more microorganisms, selecting treatment for interstitial cystitis, pelvic pain, bladder pain and myofascial pain and treating interstitial cystitis, pelvic pain, bladder pain and myofascial pain. The invention also describes detecting bacterial phenotype and kits.
    Type: Application
    Filed: November 12, 2021
    Publication date: May 12, 2022
    Applicant: CEDARS-SINAI MEDICAL CENTER
    Inventors: Anne Lenore Ackerman, David M. Underhill
  • Fungal mycobiome as probiotics, diagnostics and therapeutics
    Patent number: 9782389
    Abstract: The present invention relates to methods of using fungal mycobiome as a means of treating and/or diagnosing diseases in a subject. In one embodiment, the present invention provides a method of diagnosing inflammatory bowel disease based on the composition of fungal strains present in the gut of a subject, and treating the subject by administering a probiotic biotherapy. In another embodiment, the present invention provides a method of diagnosing a severe form of ulcerative colitis by detecting the presence of a deficiency in dectin-1 expression in s. fibuligera in the gut of a subject.
    Type: Grant
    Filed: July 18, 2016
    Date of Patent: October 10, 2017
    Assignee: CEDARS-SINAI MEDICAL CENTER
    Inventors: David M. Underhill, Iliyan D. Iliev
  • FUNGAL MYCOBIOME AS PROBIOTICS, DIAGNOSTICS AND THERAPEUTICS
    Publication number: 20160317501
    Abstract: The present invention relates to methods of using fungal mycobiome as a means of treating and/or diagnosing diseases in a subject. In one embodiment, the present invention provides a method of diagnosing inflammatory bowel disease based on the composition of fungal strains present in the gut of a subject, and treating the subject by administering a probiotic biotherapy. In another embodiment, the present invention provides a method of diagnosing a severe form of ulcerative colitis by detecting the presence of a deficiency in dectin-1 expression in s. fibuligera in the gut of a subject.
    Type: Application
    Filed: July 18, 2016
    Publication date: November 3, 2016
    Applicant: Cedars-Sinai Medical Center
    Inventors: David M. Underhill, Iliyan D. Iliev
  • Fungal mycobiome as probiotics, diagnostics and therapeutics
    Patent number: 9421233
    Abstract: The present invention relates to methods of using fungal mycobiome as a means of treating and/or diagnosing diseases in a subject. In one embodiment, the present invention provides a method of diagnosing inflammatory bowel disease based on the composition of fungal strains present in the gut of a subject, and treating the subject by administering a probiotic biotherapy. In another embodiment, the present invention provides a method of diagnosing a severe form of ulcerative colitis by detecting the presence of a deficiency in dectin-1 expression in s. fibuligera in the gut of a subject.
    Type: Grant
    Filed: April 26, 2013
    Date of Patent: August 23, 2016
    Assignee: Cedars-Sinai Medical Center
    Inventors: David M. Underhill, Iliyan D. Iliev
  • Toll-like receptor 5 ligands and methods of use
    Patent number: 9085616
    Abstract: The invention provides methods to elicit an immune response with an immunomodulatory flagellin polypeptide having toll-like receptor 5 (TLR5) binding, and further comprising an ADCC targeting molecule.
    Type: Grant
    Filed: July 26, 2011
    Date of Patent: July 21, 2015
    Assignees: THE UNIVERSITY FOR SYSTEMS BIOLOGY, UNIVERSITY OF WASHINGTON
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • FUNGAL MYCOBIOME AS PROBIOTICS, DIAGNOSTICS AND THERAPEUTICS
    Publication number: 20150110834
    Abstract: The present invention relates to methods of using fungal mycobiome as a means of treating and/or diagnosing diseases in a subject. In one embodiment, the present invention provides a method of diagnosing inflammatory bowel disease based on the composition of fungal strains present in the gut of a subject, and treating the subject by administering a probiotic biotherapy. In another embodiment, the present invention provides a method of diagnosing a severe form of ulcerative colitis by detecting the presence of a deficiency in dectin-1 expression in s. fibuligera in the gut of a subject.
    Type: Application
    Filed: April 26, 2013
    Publication date: April 23, 2015
    Applicant: CEDARS-SINAI MEDICAL CENTER
    Inventors: David M. Underhill, Iliyan D. Iliev
  • Interferon beta as antibacterial agents
    Patent number: 8936782
    Abstract: The present invention describes method of treating bacterial infections, including MRSA. In various embodiments, the methods can use interferon beta, which is found to have antimicrobial activity. In certain embodiments, the interferon beta can be human interferon beta. In other embodiments, the interferon beta can be mouse interferon beta. In further embodiments, the interferon beta can be human interferon beta containing amino acid substitutions to make the human interferon beta more cationic in neutral pH.
    Type: Grant
    Filed: November 21, 2012
    Date of Patent: January 20, 2015
    Assignee: Cedars-Sinai Medical Center
    Inventors: David M. Underhill, George Y. Liu, Amber Kaplan
  • Toll-like receptor 5 ligands and methods of use
    Patent number: 8703146
    Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.
    Type: Grant
    Filed: November 16, 2004
    Date of Patent: April 22, 2014
    Assignee: Institute for Systems Biology
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • TOLL-LIKE RECEPTOR 5 LIGANDS AND METHODS OF USE
    Publication number: 20120269855
    Abstract: The invention provides methods to elicit an immune response with an immunomodulatory flagellin polypeptide having toll-like receptor 5 (TLR5) binding, and further comprising an ADCC targeting molecule.
    Type: Application
    Filed: July 26, 2011
    Publication date: October 25, 2012
    Applicants: University of Washington, The Institute For Systems Biology
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Toll-like receptor 5 ligands and methods of use
    Patent number: 7915381
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT (SEQ ID NO:2), or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Grant
    Filed: April 17, 2002
    Date of Patent: March 29, 2011
    Assignees: Institute for Systems Biology, University of Washington
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • TOLL-LIKE RECEPTOR 5 LIGANDS AND METHODS OF USE
    Publication number: 20110008318
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Application
    Filed: August 24, 2009
    Publication date: January 13, 2011
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky
  • Toll-like receptor 5 ligands and methods of use
    Publication number: 20030044429
    Abstract: The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.
    Type: Application
    Filed: April 17, 2002
    Publication date: March 6, 2003
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly D. Smith, David M. Underhill, Adrian Ozinsky