Patents by Inventor David Snary

David Snary has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Monoclonal antibodies for use in diagnosis and treatment of colorectal cancer
    Patent number: 5965710
    Abstract: A molecule which (i) binds human membrane-bound carcinoembryonic antigen, (ii) binds a hybrid polypeptide consisting of residues 1 to 314 of human biliary glycoprotein joined (N-C) to residues 490 to C-terminus of human carcino embryonic antigen, but (iii) does not bind to human biliary glycoprotein excluding an intact mouse monoclonal antibody comprising an IgG group IIA heavy chain and a kappa group V light chain wherein the sequence of the V.sub.H chain is QVKLQQSGPELKKPGETVKISCKASGYTFTVFGMNWVKQAPGKGLKWMGWIN-TKTGEATYVEEFKGRFAFSLE TSATTAYLQINNLKNEDTAKYFCARWDFYDYVEAMDYWGQGTTVTVSS, or wherein the sequence of the V.sub.H chain is as given immediately above but the first amino acid residue of the V.sub.H CDR1 is glutamine and in either case the sequence of the V.sub.L chain is GDIVMTQSQRFMSTSVGDRVSVTCKASQNVGTNVAWYQQKPGQSPKALIYSASYRYSGVPDRFTGSG-SGTDFT LTISNVQSEDLAEYFCHQYYTYPLFTFGSGTKLEMKR. Preferably the molecule is a monoclonal antibody.
    Type: Grant
    Filed: February 23, 1996
    Date of Patent: October 12, 1999
    Assignee: Imperial Cancer Research Technology Limited
    Inventors: Walter F Bodmer, Helga Durbin, David Snary, Lorna M D Stewart, Susan Young, Paul A Bates
  • Antigenic material
    Patent number: 4341697
    Abstract: A novel, glycoprotein antigen obtained from T. cruzi organisms can be used in vaccines for inducing immunity in humans to Chagas' disease. The glycoprotein is extracted by treating trypanosomes with a detergent and separating it from the cell debris and other proteinaceous material by affinity chromatography using lectin with affinity for glucose, mannose or galactose.
    Type: Grant
    Filed: May 18, 1981
    Date of Patent: July 27, 1982
    Assignee: Burroughs Wellcome Co.
    Inventor: David Snary
  • Trypanosoma cruzi glycoprotein vaccine for inducing immunity to Chagas' disease
    Patent number: 4298596
    Abstract: A novel, glycoprotein antigen obtained from T. cruzi organisms can be used in vaccines for inducing immunity in humans to Chagas' disease. The glycoprotein is extracted by treating trypanosomes with a detergent and separating it from the cell debris and other proteinaceous material by affinity chromatography using lectin with affinity for glucose, mannose or galactose.
    Type: Grant
    Filed: March 26, 1980
    Date of Patent: November 3, 1981
    Assignee: Burroughs Wellcome Co.
    Inventor: David Snary