Abstract: Described herein are methods of treatment of an inflammatory condition related to fungal immunity. The present disclosure relates to methods and systems for identifying patients suitable for treatment with active agents, as described herein. Further, described herein are various compositions for treating and identifying a subject in need of an active agent for treatment.

Abstract: Described herein are methods for the treatment of cancer by modulating fungal populations to enhance the therapeutic response to a cancer therapy. In particular, the present invention discloses modulating the fungal microbiome in combination with a cancer therapy to enhance the anti-tumor effect.

Abstract: Described herein are methods for the treatment of cancer by modulating fungal populations to enhance the therapeutic response to a cancer therapy. In particular, the present invention discloses modulating the fungal microbiome in combination with a cancer therapy to enhance the anti-tumor effect.

Abstract: A motorized drive system for a louvre assembly of the type containing a surround frame, a pair of spaced apart operating bars positioned within the surround frame and where movement of the operating bars causes rotation of the louvres, the drive system comprising a motor adapted to be positioned within the surround frame, the motor operationally driving a drive shaft which is substantially horizontal when the drive system is fitted within the surround frame, a mounting member which is attached for rotation with the drive shaft, at least two spaced apart attachment points on the mounting member, a first link arm, a second link arm and a third link arm, the first link arm being attached to one of the attachment points and to one said operating bar, the second link arm being attached to another of the attachment points, the third link arm being pivotally attached to the second link arm and to the other operating bar.

Abstract: A motorised drive system for a louvre assembly of the type containing a surround frame, a pair of spaced apart operating bars positioned within the surround frame and where movement of the operating bars causes rotation of the louvres, the drive system comprising a motor adapted to be positioned within the surround frame, the motor operationally driving a drive shaft which is substantially horizontal when the drive system is fitted within the surround frame, a mounting member which is attached for rotation with the drive shaft, at least two spaced apart attachment points on the mounting member, a first link arm, a second link arm and a third link arm, the first link arm being attached to one of the attachment points and to one said operating bar, the second link arm being attached to another of the attachment points, the third link arm being pivotally attached to the second link arm and to the other operating bar.

Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.