Abstract: Described herein are methods of treatment of an inflammatory condition related to fungal immunity. The present disclosure relates to methods and systems for identifying patients suitable for treatment with active agents, as described herein. Further, described herein are various compositions for treating and identifying a subject in need of an active agent for treatment.

Abstract: Described herein are methods for the treatment of cancer by modulating fungal populations to enhance the therapeutic response to a cancer therapy. In particular, the present invention discloses modulating the fungal microbiome in combination with a cancer therapy to enhance the anti-tumor effect.

Abstract: Described herein are methods for the treatment of cancer by modulating fungal populations to enhance the therapeutic response to a cancer therapy. In particular, the present invention discloses modulating the fungal microbiome in combination with a cancer therapy to enhance the anti-tumor effect.

Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.