Patents by Inventor David Underhill

David Underhill has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20220260565
    Abstract: Described herein are methods of treatment of an inflammatory condition related to fungal immunity. The present disclosure relates to methods and systems for identifying patients suitable for treatment with active agents, as described herein. Further, described herein are various compositions for treating and identifying a subject in need of an active agent for treatment.
    Type: Application
    Filed: September 19, 2019
    Publication date: August 18, 2022
    Applicant: CEDARS-SINAI MEDICAL CENTER
    Inventors: David Underhill, Dermot McGovern, Jose Limon, Gil Y. Melmed
  • Patent number: 10772903
    Abstract: Described herein are methods for the treatment of cancer by modulating fungal populations to enhance the therapeutic response to a cancer therapy. In particular, the present invention discloses modulating the fungal microbiome in combination with a cancer therapy to enhance the anti-tumor effect.
    Type: Grant
    Filed: September 12, 2017
    Date of Patent: September 15, 2020
    Assignee: Cedars-Sinai Medical Center
    Inventors: Stephen Shiao, David Underhill
  • Patent number: 8336256
    Abstract: A motorized drive system for a louvre assembly of the type containing a surround frame, a pair of spaced apart operating bars positioned within the surround frame and where movement of the operating bars causes rotation of the louvres, the drive system comprising a motor adapted to be positioned within the surround frame, the motor operationally driving a drive shaft which is substantially horizontal when the drive system is fitted within the surround frame, a mounting member which is attached for rotation with the drive shaft, at least two spaced apart attachment points on the mounting member, a first link arm, a second link arm and a third link arm, the first link arm being attached to one of the attachment points and to one said operating bar, the second link arm being attached to another of the attachment points, the third link arm being pivotally attached to the second link arm and to the other operating bar.
    Type: Grant
    Filed: December 13, 2006
    Date of Patent: December 25, 2012
    Assignee: Assa Abloy Australia Pty Ltd
    Inventors: Craig Robert Jeffrey, Ian David Underhill
  • Publication number: 20090307978
    Abstract: A motorised drive system for a louvre assembly of the type containing a surround frame, a pair of spaced apart operating bars positioned within the surround frame and where movement of the operating bars causes rotation of the louvres, the drive system comprising a motor adapted to be positioned within the surround frame, the motor operationally driving a drive shaft which is substantially horizontal when the drive system is fitted within the surround frame, a mounting member which is attached for rotation with the drive shaft, at least two spaced apart attachment points on the mounting member, a first link arm, a second link arm and a third link arm, the first link arm being attached to one of the attachment points and to one said operating bar, the second link arm being attached to another of the attachment points, the third link arm being pivotally attached to the second link arm and to the other operating bar.
    Type: Application
    Filed: December 13, 2006
    Publication date: December 17, 2009
    Inventors: Craig Robert Jeffrey, Ian David Underhill
  • Publication number: 20050147627
    Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.
    Type: Application
    Filed: November 16, 2004
    Publication date: July 7, 2005
    Inventors: Alan Aderem, Fumitaka Hayashi, Kelly Smith, David Underhill, Adrian Ozinsky
  • Patent number: D502383
    Type: Grant
    Filed: February 3, 2004
    Date of Patent: March 1, 2005
    Assignee: The Steelworks Corporation
    Inventors: David Underhill, Dario Pompeii
  • Patent number: D502384
    Type: Grant
    Filed: February 3, 2004
    Date of Patent: March 1, 2005
    Assignee: The Steelworks Corporation
    Inventors: David Underhill, Dario Pompeii
  • Patent number: D502385
    Type: Grant
    Filed: February 3, 2004
    Date of Patent: March 1, 2005
    Assignee: The Steelworks Corporation
    Inventors: David Underhill, Dario Pompeii
  • Patent number: D467155
    Type: Grant
    Filed: April 6, 2001
    Date of Patent: December 17, 2002
    Assignee: Schlage Lock Company
    Inventors: David Underhill, Laura Zoerner