Abstract: In order to prepare a UV protective agent for topical application to the skin or hair with very high UV filter substance concentration and with good adhesion to the skin and hair, according to the invention the UV protective agent is proposed with at least one UV filter substance, which is encapsulated in a vesicular carrier system, in which the UV protective agent is characterized by the fact that the at least one UV filter substance encapsulated in the vesicular carrier system is lipophilic and the vesicular carrier system consists of vesicles constructed from hydrophobized polysaccharides and having a particle size from 10 to 1000 nm, as well as a positive surface charge with a zeta potential in the range from 1 to 150 mV by means of the charge donors contained therein. In addition, use of such a UV protective agent in corresponding cosmetic and/or pharmaceutical formulations is proposed.

Abstract: The present invention concerns cosmetic compositions for coloring hair comprising at least one direct hair dye and a carrier system for the at least one direct hair dye, the use of such compositions in cosmetic formulations for coloring hair and processes for the production of the compositions.

Abstract: The present invention concerns cosmetic compositions for coloring hair comprising at least one direct hair dye and a carrier system for the at least one direct hair dye, and the use of such compositions in cosmetic formulations for coloring hair. To provide a possible way with which the permanence of the bond of direct hair dyes to the hair can be improved, with the aim of direct dyes remaining on the hair for as long as possible to deliver the desired hair color in the desired quality for as long as possible, according to the invention there are proposed compositions of the aforementioned kind in which the carrier system is vesicular and comprises vesicles which are made up from hydrophobised polysaccharides and have a particle size of between 10 and 1000 nm as well as a positive surface charge with a zeta potential in the range of between 1 and 150 mV.

Abstract: The present invention concerns cosmetic compositions for coloring hair comprising at least one direct hair dye and a carrier system for the at least one direct hair dye, and the use of such compositions in cosmetic formulations for coloring hair. To provide a possible way with which the permanence of the bond of direct hair dyes to the hair can be improved, with the aim of direct dyes remaining on the hair for as long as possible to deliver the desired hair color in the desired quality for as long as possible, according to the invention there are proposed compositions of the aforementioned kind in which the carrier system is vesicular and comprises vesicles which are made up from hydrophobised polysaccharides and have a particle size of between 10 and 1000 nm as well as a positive surface charge with a zeta potential in the range of between 1 and 150 mV.

Abstract: The present invention concerns cosmetic compositions for coloring hair comprising at least one direct hair dye and a carrier system for the at least one direct hair dye, the use of such compositions in cosmetic formulations for coloring hair and processes for the production of the compositions.

Abstract: Use of hPTH-1-37 having the amino acid sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID No. 1) or one of its natural and pharmacologically compatible derivatives, especially amidated, acylated, phosphorylated and glycosylated derivatives, for preparing a medicament for the treatment of inflammatory scaling (erythematosquamous) diseases, especially psoriasis, wherein hPTH-1-37 (SEQ ID No. 1) is present in an amount of from 300 ?g to 30 mg per gram of medicament.

Abstract: The present invention concerns a composition having at least one sirtuin activator and a carrier system for the at least one sirtuin activator, wherein the carrier system includes lipid vesicles with one or more lipid membranes.

Abstract: To provide a UV protection agent for topical application to the skin or hair with a very high UV filter substance concentration and good adhesion to skin and hair in accordance with the invention there is proposed a UV protection agent having at least one UV filter substrate encapsulated in a vesicle carrier system, wherein the UV protection agent is characterised in that the at least one UV filter substance encapsulated in the vesicular carrier system is soluble in oil and the vesicular carrier system comprises vesicles which are made up of hydrophobised polysaccharides and are of a particle size of between 10 and 1000 nm and have a positive surface charge with a zeta potential in the range of between 1 and 150 mV. In addition there is proposed the use of such a UV protection agent in suitable cosmetic and/or pharmaceutical formulations.

Abstract: A combined cosmetic or therapeutic preparation having a carrier system comprising membrane-forming lipids and at least two active ingredients which are selected from at least two of the groups (a) anti-coagulants, (b) vasoprotective agents and (c) microcirculation-promoting substances. The invention also includes the method for making the preparation from its ingredients.

Abstract: A cosmetic composition containing from about 1% to about 50% by weight of membrane-forming sphingolipids and/or galactolipids and about 5% to about 50% by weight of a fluorocarbon or fluorocarbon mixture charged with oxygen. Surprisingly, it has been shown that the use of membrane-forming sphingolipids and/or galactolipids as transport vesicles or for the formation of transport vesicles for a fluorocarbon or fluorocarbon mixture charged with oxygen results in excellent transport of oxygen through the stratum corneum of the skin and the epidermis in a manner which is far superior to known transport systems.

Abstract: A cosmetic or therapeutic composition with a proportion of substantially free amino acids as well as the use of such a composition for improving skin moistness, skin elasticity and/or for skin wrinkle reduction. In accordance with the invention proposed for that purpose is a cosmetic or therapeutic composition having a proportion of substantially free amino acids, which includes at least theanine and an amino acid selected from aspartic acid and glutamic acid, wherein the proportion of substantially free amino acids additionally contains at least two amino acids which are selected from alanine, glycine, threonine and serine. The invention also includes a method for preparing the composition.