Abstract: Use of hPTH-1-37 having the amino acid sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL (SEQ ID No. 1) or one of its natural and pharmacologically compatible derivatives, especially amidated, acylated, phosphorylated and glycosylated derivatives, for preparing a medicament for the treatment of inflammatory scaling (erythematosquamous) diseases, especially psoriasis, wherein hPTH-1-37 (SEQ ID No. 1) is present in an amount of from 300 ?g to 30 mg per gram of medicament.

Abstract: A combined cosmetic or therapeutic preparation having a carrier system comprising membrane-forming lipids and at least two active ingredients which are selected from at least two of the groups (a) anti-coagulants, (b) vasoprotective agents and (c) microcirculation-promoting substances. The invention also includes the method for making the preparation from its ingredients.

Abstract: A cosmetic composition containing from about 1% to about 50% by weight of membrane-forming sphingolipids and/or galactolipids and about 5% to about 50% by weight of a fluorocarbon or fluorocarbon mixture charged with oxygen. Surprisingly, it has been shown that the use of membrane-forming sphingolipids and/or galactolipids as transport vesicles or for the formation of transport vesicles for a fluorocarbon or fluorocarbon mixture charged with oxygen results in excellent transport of oxygen through the stratum corneum of the skin and the epidermis in a manner which is far superior to known transport systems.

Abstract: A cosmetic or therapeutic composition with a proportion of substantially free amino acids as well as the use of such a composition for improving skin moistness, skin elasticity and/or for skin wrinkle reduction. In accordance with the invention proposed for that purpose is a cosmetic or therapeutic composition having a proportion of substantially free amino acids, which includes at least theanine and an amino acid selected from aspartic acid and glutamic acid, wherein the proportion of substantially free amino acids additionally contains at least two amino acids which are selected from alanine, glycine, threonine and serine. The invention also includes a method for preparing the composition.