Patents by Inventor Edwin W. Ades
Edwin W. Ades has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).
-
Patent number: 9101582Abstract: Methods for enhancing opsonophagocytosis of a pathogen of interest are disclosed. The disclosed methods include administering to a subject an isolated P4 peptide, which includes the amino acid sequence set forth as SEQ ID NO: 1 and optionally an isolated opsonic antibody or a fragment thereof that specifically binds to an antigen present on the surface of the pathogen of interest. In some examples isolated complement protein or a fragment thereof (for example, a C3a, C3b, iC3b, C3d, C4b, or C5a fragment of a complement protein) is also administered. Compositions containing isolated P4 peptide and one or more isolated opsonic antibodies or a fragment thereof that specifically binds to an antigen present on the surface of a pathogen of interest are also disclosed. In some examples, the compositions also include isolated complement protein or fragment thereof, such as one or more of C3a, C3b, iC3b, C3d, C4b, or C5a.Type: GrantFiled: March 27, 2013Date of Patent: August 11, 2015Assignee: The United States of America as represented by the Secretary of the Department of Health and Human Services, Centers for Disease Control and PreventionInventors: Edwin W. Ades, Gowrisankar Rajam, Sandra Steiner, George M. Carlone, Nikkol Melnick, Jacquelyn S. Sampson, Joseph E. Martinez, Julie M. Skinner
-
Patent number: 8642048Abstract: The invention provides a nucleic acid encoding the 37-kDa pneumococcal surface adhesion A protein (PsaA) from Streptococcus pneumoniae. The invention also provides purified polypeptides encoded by the nucleic acid encoding the 37-kDa protein from and the nucleic acids comprising unique fragment of at least 10 nucleotides of the 37-kDa protein. Additionally, multiple antigenic peptides that provide protection against S. pneumoniae challenge are provided. These multiple antigen peptides comprise the peptides that immunospecifically bind to the monoclonal antibodies. Also provided are vaccines comprising such immunogenic peptides, and methods of conferring protective immunity against Streptococcus pneumoniae infection by administering therapeutic composition comprising the immunogenic peptides of the invention.Type: GrantFiled: January 27, 2009Date of Patent: February 4, 2014Assignee: The United States of America, as Represented by the Secretary of the Department of Health and Human Services, Centers for Disease Control and PreventionInventors: Edwin W. Ades, Scott E. Johnson, Danny L. Jue, Jacquelyn S. Sampson, George M. Carlone
-
Patent number: 8637050Abstract: This invention, in one aspect, relates to synthetic immunoreactive peptides. These peptides are approximately 20-25 amino acids in length which are portions of the N termini of the M proteins of the most prevalent United States (U.S.) Group A Streptococcus (GAS) serotypes. At least some of the synthetic peptides can be recognized by M type-specific antibodies and are capable of eliciting functional opsonic antibodies and/or anti-attachment antibodies without eliciting tissue cross-reactive antibodies. In another aspect, it relates to compositions or vaccines comprising these synthetic serotype-specific peptides, including polypeptides and proteins. The invention may also be isolated antibodies which are raised in response to the peptides, compositions or vaccines. The invention further relates to kits for using the peptides, compositions, or antibodies.Type: GrantFiled: March 18, 2013Date of Patent: January 28, 2014Assignee: The United States of America, as represented by the Secretary, Department of Health and Human Services, Centers for Disease Control and PreventionInventors: Bernard W. Beall, George M. Carlone, Jacquelyn S. Sampson, Edwin W. Ades
-
Patent number: 8431134Abstract: Methods for enhancing opsonophagocytosis of a pathogen of interest are disclosed. The disclosed methods include administering to a subject an isolated P4 peptide, which includes the amino acid sequence set forth as SEQ ID NO: 1 and optionally an isolated opsonic antibody or a fragment thereof that specifically binds to an antigen present on the surface of the pathogen of interest. In some examples isolated complement protein or a fragment thereof (for example, a C3a, C3b, iC3b, C3d, C4b, or C5a fragment of a complement protein) is also administered. Compositions containing isolated P4 peptide and one or more isolated opsonic antibodies or a fragment thereof that specifically binds to an antigen present of the surface of a pathogen of interest are also disclosed. In some examples, the compositions also include isolated complement protein or fragment thereof, such as one or more of C3a, C3b, iC3b, C3d, C4b, or C5a.Type: GrantFiled: July 31, 2009Date of Patent: April 30, 2013Assignee: The United States of America as represented by the Secretary of the Department of Health and Human Services, Centers for Disease Control and PreventionInventors: Edwin W. Ades, Gowrisankar Rajam, Sandra Steiner, George M. Carlone, Nikkoj Melnick, Jacquelyn S. Sampson, Joseph E. Martinez, Julie M. Skinner
-
Patent number: 8420107Abstract: This invention, in one aspect, relates to synthetic immunoreactive peptides. These peptides are approximately 20-25 amino acids in length which are portions of the N termini of the M proteins of the most prevalent United States (U.S.) Group A Streptococcus (GAS) serotypes. At least some of the synthetic peptides can be recognized by M type-specific antibodies and are capable of eliciting functional opsonic antibodies and/or anti-attachment antibodies without eliciting tissue cross-reactive antibodies. In another aspect, it relates to compositions or vaccines comprising these synthetic serotype-specific peptides, including polypeptides and proteins. The invention may also be isolated antibodies which are raised in response to the peptides, compositions or vaccines. The invention further relates to kits for using the peptides, compositions, or antibodies.Type: GrantFiled: March 22, 2012Date of Patent: April 16, 2013Assignee: The United States of America, as represented by the Secretary, Department of Health and Human Services, Centers for Disease Control and PreventionInventors: Bernard W. Beall, George M. Carlone, Jacquelyn S. Sampson, Edwin W. Ades
-
Publication number: 20120177685Abstract: This invention, in one aspect, relates to synthetic immunoreactive peptides. These peptides are approximately 20-25 amino acids in length which are portions of the N termini of the M proteins of the most prevalent United States (U.S.) Group A Streptococcus (GAS) serotypes. At least some of the synthetic peptides can be recognized by M type-specific antibodies and are capable of eliciting functional opsonic antibodies and/or anti-attachment antibodies without eliciting tissue cross-reactive antibodies. In another aspect, it relates to compositions or vaccines comprising these synthetic serotype-specific peptides, including polypeptides and proteins. The invention may also be isolated antibodies which are raised in response to the peptides, compositions or vaccines. The invention further relates to kits for using the peptides, compositions, or antibodies.Type: ApplicationFiled: March 22, 2012Publication date: July 12, 2012Inventors: Bernard W. Beall, George M. Carlone, Jacquelyn S. Sampson, Edwin W. Ades
-
Publication number: 20110195075Abstract: Methods for enhancing opsonophagocytosis of a pathogen of interest are disclosed. The disclosed methods include administering to a subject an isolated P4 peptide, which including the amino acid sequence set forth as SEQ ID NO: 1 and optionally an isolated opsonic antibody or a fragment thereof that specifically binds to an antigen present of the surface of the pathogen of interest. In some examples isolated complement protein or a fragment thereof (for example, a C3a, C3b, iC3b, C3d, C4b, or C5a fragment of a complement protein) is also administering. Compositions contain isolated P4 peptide and one or more isolated opsonic antibodies or a fragment thereof that specifically binds to an antigen present of the surface of a pathogen of interest are also disclosed. In some examples, the compositions also isolated complement protein or fragment thereof, such as one or more of C3a, C3b, iC3b, C3d, C4b, or C5a.Type: ApplicationFiled: July 31, 2009Publication date: August 11, 2011Inventors: Edwin W. Ades, Gowrisankar Rajam, Sandra Steiner, George M. Carlone, Nikkol Melnick, Jacquelyn S. Sampson, Joseph E. Martinez, Julie M. Skinner
-
Patent number: 7960535Abstract: The present invention relates to recombinant lipidated PsaA proteins and recombinant constructs from which such lipidated PsaA proteins may be expressed. The invention relates further to lipidated PsaA proteins in which lipidation is effected by the use of a heterologous leader sequence derived from the ospA gene of Borrelia burgdorferi, which leader sequence is joined in translational reading frame with the psaA structural gene. The invention also provides methods of preparation of lipidated PsaA proteins and use of such proteins in immunological compositions. Also provided are vaccines comprising immunogenic lipidated PsaA proteins and methods of use of such vaccines in the prevention and treatment of S. pneumoniae infection.Type: GrantFiled: November 16, 2009Date of Patent: June 14, 2011Assignee: The United States of America as represented by the Department of Health and Human ServicesInventors: Edwin W. Ades, George M. Carlone, Barun K. De, Jacquelyn S. Sampson, Robert C. Huebner
-
Publication number: 20110110969Abstract: This invention, in one aspect, relates to synthetic immunoreactive peptides. These peptides are approximately 20-25 amino acids in length which are portions of the N termini of the M proteins of the most prevalent United States (U.S.) Group A Streptococcus (GAS) serotypes. At least some of the synthetic peptides can be recognized by M type-specific antibodies and are capable of eliciting functional opsonic antibodies and/or anti-attachment antibodies without eliciting tissue cross-reactive antibodies. In another aspect, it relates to compositions or vaccines comprising these synthetic serotype-specific peptides, including polypeptides and proteins. The invention may also be isolated antibodies which are raised in response to the peptides, compositions or vaccines. The invention further relates to kits for using the peptides, compositions, or antibodies.Type: ApplicationFiled: December 20, 2010Publication date: May 12, 2011Inventors: Bernard W. Beall, George M. Carlone, Jacquelyn S. Sampson, Edwin W. Ades
-
Patent number: 7919104Abstract: Provided is a P4 peptide, which contains functional epitopes of the PsaA protein of Streptococcus pneumoniae, and related methods and compositions. P4 peptide mimetics having a conformational structure identical or similar to the conformation of P4 (e.g., SEQ ID NO: 1 and SEQ ID NO:2) are provided. An antibody that specifically binds to the epitope defined by the disclosed peptides is provided. A P4-specific antibody is PsaA-specific since P4 defines an epitope specific for PsaA. Immunogenic compositions comprising the peptide of SEQ ID NO: 1 and a pharmaceutical carrier or the peptide of SEQ ID NO:2 and a pharmaceutical carrier are also provided. Methods of using the peptides and antibodies of the invention are provided.Type: GrantFiled: July 29, 2005Date of Patent: April 5, 2011Assignee: The United States of America as represented by the Department of Health and Human Services, Centers for Disease Control and PreventionInventors: Edwin W. Ades, Jacquelyn S. Sampson, Sandra Steiner, George M. Carlone, Joseph J. Caba, GowriSankar Rajam
-
Patent number: 7883710Abstract: This invention, in one aspect, relates to synthetic immunoreactive peptides. These peptides are approximately 20-25 amino acids in length which are portions of the N termini of the M proteins of the most prevalent United States (U.S.) Group A Streptococcus (GAS) serotypes. At least some of the synthetic peptides can be recognized by M type-specific antibodies and are capable of eliciting functional opsonic antibodies and/or anti-attachment antibodies without eliciting tissue cross-reactive antibodies. In another aspect, it relates to compositions or vaccines comprising these synthetic serotype-specific peptides, including polypeptides and proteins. The invention may also be isolated antibodies which are raised in response to the peptides, compositions or vaccines. The invention further relates to kits for using the peptides, compositions, or antibodies.Type: GrantFiled: June 23, 2008Date of Patent: February 8, 2011Assignee: The United States of America as represented by the Department of Health and Human ServicesInventors: Bernard W. Beall, George M. Carlone, Jacquelyn S. Sampson, Edwin W. Ades
-
Publication number: 20100260802Abstract: The present invention relates to recombinant lipidated PsaA proteins and recombinant constructs from which such lipidated PsaA proteins may be expressed. The invention relates further to lipidated PsaA proteins in which lipidation is effected by the use of a heterologous leader sequence derived from the ospA gene of Borrelia burgdorferi, which leader sequence is joined in translational reading frame with the psaA structural gene. The invention also provides methods of preparation of lipidated PsaA proteins and use of such proteins in immunological compositions. Also provided are vaccines comprising immunogenic lipidated PsaA proteins and methods of use of such vaccines in the prevention and treatment of S. pneumoniae infection.Type: ApplicationFiled: November 16, 2009Publication date: October 14, 2010Inventors: Edwin W. Ades, George M. Carlone, Barun K. De, Jacquelyn S. Sampson, Robert C. Huebner
-
Patent number: 7635486Abstract: The present invention relates to recombinant lipidated PsaA proteins and recombinant constructs from which such lipidated PsaA proteins may be expressed. The invention relates further to lipidated PsaA proteins in which lipidation is effected by the use of a heterologous leader sequence derived from the ospA gene of Borrelia burgdorferi, which leader sequence is joined in translational reading frame with the psaA structural gene. The invention also provides methods of preparation of lipidated PsaA proteins and use of such proteins in immunological compositions. Also provided are vaccines comprising immunogenic lipidated PsaA proteins and methods of use of such vaccines in the prevention and treatment of S. pneumoniae infection.Type: GrantFiled: January 14, 1999Date of Patent: December 22, 2009Assignee: The United States of America as represented by the Department of Health and Human ServicesInventors: Edwin W. Ades, George M. Carlone, Barun K. De, Jacquelyn S. Sampson, Robert C. Huebner
-
Publication number: 20090136548Abstract: The invention provides a nucleic acid encoding the 37-kDa pneumococcal surface adhesion A protein (PsaA) from Streptococcus pneumoniae. The invention also provides purified polypeptides encoded by the nucleic acid encoding the 37-kDa protein from and the nucleic acids comprising unique fragment of at least 10 nucleotides of the 37-kDa protein. Additionally, multiple antigenic peptides that provide protection against S. pneumoniae challenge are provided. These multiple antigen peptides comprise the peptides that immunospecifically bind to the monoclonal antibodies. Also provided are vaccines comprising such immunogenic peptides, and methods of conferring protective immunity against Streptococcus pneumoniae infection by administering therapeutic composition comprising the immunogenic peptides of the invention.Type: ApplicationFiled: January 27, 2009Publication date: May 28, 2009Inventors: Edwin W. Ades, Scott E. Johnson, Danny L. Jue, Jacquelyn S. Sampson, George M. Carlone
-
Patent number: 7501132Abstract: The invention provides a nucleic acid encoding the 37-kDa pneumococcal surface adhesion A protein (PsaA) from Streptococcus pneumoniae. Also provided are isolated nucleic acids comprising a unique fragment of at least 10 nucleotides of the 37-kDa protein. The invention also provides purified polypeptides encoded by the nucleic acid encoding the 37-kDa protein from and the nucleic acids comprising unique fragment of at least 10 nucleotides of the 37-kDa protein. The invention further provides monoclonal antibodies which selectively bind PsaA. In addition, peptides are provided that immunospecifically bind to the monoclonal antibodies of the invention, and that are immunogenic against Streptococcus pneumoniae infection. Additionally, multiple antigenic peptides that provide protection against S. pneumoniae challenge are provided. These multiple antigen peptides comprise the peptides that immunospecifically bind to the monoclonal antibodies.Type: GrantFiled: June 6, 2005Date of Patent: March 10, 2009Assignee: The United States of America as represented by the Department of Health and Human ServicesInventors: Edwin W. Ades, Scott E. Johnson, Danny L. Jue, Jacquelyn S. Sampson, George M. Carlone
-
Patent number: 7476733Abstract: Disclosed are compositions and methods for detecting a specific sequence of the psaA gene using real-time PCR for diagnosis of Pneumococcal Disease.Type: GrantFiled: March 25, 2005Date of Patent: January 13, 2009Assignee: The United States of America as represented by the Department of Health and Human ServicesInventors: Maria da Gloria Carvalho, Jacquelyn S. Sampson, Edwin W. Ades, George Carlone, Karen McCaustland
-
Publication number: 20080305123Abstract: Provided is a P4 peptide, which contains functional epitopes of the PsaA protein of Streptococcus pneumoniae, and related methods and compositions. A peptide that comprises the amino acid sequence defined in SEQ ID NO:1 (an example of the P4 peptide) is provided. Also provided is a peptide comprising the amino acid sequence defined as VPSLFVDSSVDDRPMKTVSQDTNIPIYAQIFTDS (SEQ ID NO:2). P4 peptide mimetics having a conformational structure identical or similar to the conformation of P4 (e.g., SEQ ID NO: 1 and SEQ ID NO:2) are provided. An antibody that specifically binds to the epitope defined by the disclosed peptides is provided. For example, the antibody can specifically bind to a peptide comprising the sequence set forth in SEQ ID NO: 1 and having the conformation defined by the peptide consisting of SEQ ID NO: 1. An antibody that specifically binds to a peptide comprising the sequence set forth in SEQ ID NO:2 and having the conformation defined by the peptide consisting of SEQ ID NO:2 is also provided.Type: ApplicationFiled: July 29, 2005Publication date: December 11, 2008Inventors: Edwin W. Ades, Jacquelyn S. Sampson, Sandra Steiner, George M. Carlone, Joseph J. Caba, GowriSankar Rajam
-
Publication number: 20080279880Abstract: This invention, in one aspect, relates to synthetic immunoreactive peptides. These peptides are approximately 20-25 amino acids in length which are portions of the N termini of the M proteins of the most prevalent United States (U.S.) Group A Streptococcus (GAS) serotypes. At least some of the synthetic peptides can be recognized by M type-specific antibodies and are capable of eliciting functional opsonic antibodies and/or anti-attachment antibodies without eliciting tissue cross-reactive antibodies. In another aspect, it relates to compositions or vaccines comprising these synthetic serotype-specific peptides, including polypeptides and proteins. The invention may also be isolated antibodies which are raised in response to the peptides, compositions or vaccines. The invention further relates to kits for using the peptides, compositions, or antibodies.Type: ApplicationFiled: June 23, 2008Publication date: November 13, 2008Inventors: Bernard W. Beall, George M. Carlone, Jacquelyn S. Sampson, Edwin W. Ades
-
Patent number: 7407664Abstract: This invention, in one aspect, relates to synthetic immunoreactive peptides. These peptides are approximately 20-25 amino acids in length which are portions of the N termini of the M proteins of the most prevalent United States (U.S.) Group A Streptococcus (GAS) serotypes. At least some of the synthetic peptides can be recognized by M type-specific antibodies and are capable of eliciting functional opsonic antibodies and/or anti-attachment antibodies without eliciting tissue cross-reactive antibodies. In another aspect, it relates to compositions or vaccines comprising these synthetic serotype-specific peptides, including polypeptides and proteins. The invention may also be isolated antibodies which are raised in response to the peptides, compositions or vaccines. The invention further relates to kits for using the peptides, compositions, or antibodies.Type: GrantFiled: May 20, 2002Date of Patent: August 5, 2008Assignee: The United States of America as represented by the Secretary of the Department of Health and Human Services, Centers for Disease Control and PreventionInventors: Bernard W. Beall, George M. Carlone, Jacquelyn S. Sampson, Edwin W. Ades
-
Patent number: 7223836Abstract: Peptides are disclosed that include SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, and SEQ ID NO:6, or a conservative variant or mimic thereof, wherein the conservative variant or mimic specifically binds an antibody that specifically binds SEQ ID NO:1, SEQ ID NO: 2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID or NO:6. These peptides are of use in generating an immune response against C. pneumoniae, or in preventing infection with against C. pneumoniae.Type: GrantFiled: May 31, 2002Date of Patent: May 29, 2007Assignee: The United States of America as represented by the Secretary of the Department of Health and Human Services, Centers for Disease Control and PreventionInventors: Eric L. Marston, Jackie S. Sampson, George M. Carlone, Edwin W. Ades