Patents by Inventor Elena Kage

Elena Kage has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 11351267
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Grant
    Filed: June 15, 2020
    Date of Patent: June 7, 2022
    Assignee: Cilag GMBH International
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Publication number: 20200345859
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Application
    Filed: June 15, 2020
    Publication date: November 5, 2020
    Applicant: Covagen AG
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Patent number: 10722589
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Grant
    Filed: April 2, 2018
    Date of Patent: July 28, 2020
    Assignee: Covagen AG
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger
  • Publication number: 20190153096
    Abstract: Advantageous bispecific binding molecules that comprise a CD3 binding and a CD33 binding part are provided. The CD3 binding part comprises an antibody that has variations in the Fc region with reduced binding to C1q and Fc gamma receptors. The bispecific binding molecules can be used in the treatment of cancer.
    Type: Application
    Filed: September 25, 2018
    Publication date: May 23, 2019
    Applicant: Covagen AG
    Inventors: Simon Brack, Kristina Klupsch, Isabella Attinger-Toller, Fabian Buller, Adrian Zumsteg, Julian Bertschinger, Dragan Grabulovski, Vanessa Baeriswyl, Joana Roquette, Roland Scholz, Roger Santimaria, David Senn, Elena Kage, Clara Albani
  • Publication number: 20180280527
    Abstract: The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X1)(X2)(X3) (X4)GPYWEARSL(X5)TGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X6)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X6) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the ami
    Type: Application
    Filed: April 2, 2018
    Publication date: October 4, 2018
    Applicant: Covagen AG
    Inventors: Michela Silacci Melkko, Richard Woods, Patricia Henne, Barbara Zubler, Elena Kage, Dragan Grabulovski, Julian Bertschinger