Patents by Inventor Erwin Soutschek

Erwin Soutschek has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 11169153
    Abstract: Herein disclosed is a method for the normalization of an immunological test, characterized in that the presence of a comparable amount of cells is determined by a sandwich ELISA test in which the capture antibody includes at least one antibody that binds to at least one keratin selected from among keratin 4, 5, 6, 8, 10, 13 and 18 and the detection antibody includes at least one antibody that binds to the selected keratin.
    Type: Grant
    Filed: July 28, 2016
    Date of Patent: November 9, 2021
    Assignee: Mikrogen GmbH
    Inventors: Isabel Koch, Oliver Boecher, Erwin Soutschek, Steven McNamara
  • Patent number: 10921323
    Abstract: The present invention relates to a method for the immunological diagnosis of a sample from a patient with a potential infection with an arbovirus, wherein a) a sample is brought into contact with a plurality of antigens that, separated from each other, are applied to a solid phase, wherein at least the following antigens are used: aa) the “non-structural protein 1” of a first arbovirus or an immunologically reactive part thereof having at least 8 amino acids, bb) an “envelope protein” of a first arbovirus or an immunologically reactive part thereof having at least 8 amino acids, cc) an “envelope protein” of a second arbovirus or an immunologically reactive part thereof having at least 8 amino acids, dd) the “non-structural protein 1” of a third arbovirus or an immunologically reactive part thereof having at least 8 amino acids and ee) an “envelope protein” of a third arbovirus or an immunologically reactive part thereof having at least 8 amino acids, b) the solid phase is washed to separate non-specific b
    Type: Grant
    Filed: October 17, 2017
    Date of Patent: February 16, 2021
    Assignee: Mikrogen GmbH
    Inventors: Erwin Soutschek, Oliver Boecher, Christina Noelting
  • Publication number: 20190227065
    Abstract: The present invention relates to a method for the immunological diagnosis of a sample from a patient with a potential infection with an arbovirus, wherein a) a sample is brought into contact with a plurality of antigens that, separated from each other, are applied to a solid phase, wherein at least the following antigens are used: aa) the “non-structural protein 1” of a first arbovirus or an immunologically reactive part thereof having at least 8 amino acids, bb) an “envelope protein” of a first arbovirus or an immunologically reactive part thereof having at least 8 amino acids, cc) an “envelope protein” of a second arbovirus or an immunologically reactive part thereof having at least 8 amino acids, dd) the “non-structural protein 1” of a third arbovirus or an immunologically reactive part thereof having at least 8 amino acids and ee) an “envelope protein” of a third arbovirus or an immunologically reactive part thereof having at least 8 amino acids, b) the solid phase is washed to separate non-specific
    Type: Application
    Filed: October 17, 2017
    Publication date: July 25, 2019
    Inventors: Erwin SOUTSCHEK, Oliver BOECHER, Christina NOELTING
  • Publication number: 20190079091
    Abstract: The present invention relates to a method for the normalization of an immunological test characterized in that the presence of a comparable amount of cells is determined by a sandwich ELISA test wherein the capture antibody is at least one antibody which binds to at least one keratin selected from the group consisting of keratin 4, 5, 6, 8, 10, 13 and 18 and the detection antibody is at least one antibody which binds to said keratin.
    Type: Application
    Filed: July 28, 2016
    Publication date: March 14, 2019
    Applicant: Mikrogen GmbH
    Inventors: Isabel KOCH, Oliver BOECHER, Erwin SOUTSCHEK, Steven MCNAMARA
  • Publication number: 20180259523
    Abstract: The present invention relates to a diagnostic test for the detection of an E7 protein of a human papilloma virus in a biological sample wherein a sandwich ELISA as capture antibody at least two different rabbit monoclonal antibodies which bind to at least two different epitopes are used and as detection antibody at least two different polyclonal anti E7 antibodies are used.
    Type: Application
    Filed: October 30, 2015
    Publication date: September 13, 2018
    Applicants: Mikrogen GmbH, Österreichische Akademie der Wissenschaften
    Inventors: Pidder JANSEN-DÜRR, Oliver BÖCHER, Isabel KOCH, Erwin SOUTSCHEK
  • Patent number: 8580521
    Abstract: Devices are disclosed for serologically detecting an infection with human-pathogenic Yersinia ssp, wherein said device comprises at least one antigen selected from the group of antigens consisting of the following group: YopD, YopH, YopM, YopE, V-AG and YopN or a fragment of one of said antigens having at least eight consecutive amino acids and furthermore one of two proteins selected from MyfA and PsaA or fragments of one of said two proteins having at least eight consecutive amino acids.
    Type: Grant
    Filed: February 11, 2010
    Date of Patent: November 12, 2013
    Assignee: Mikrogen GmbH
    Inventor: Erwin Soutschek
  • Publication number: 20110306515
    Abstract: Devices are disclosed for serologically detecting an infection with human-pathogenic Yersinia ssp, wherein said device comprises at least one antigen selected from the group of antigens consisting of the following group: YopD, YopH, YopM, YopE, V-AG and YopN or a fragment of one of said antigens having at least eight consecutive amino acids and furthermore one of two proteins selected from MyfA and PsaA or fragments of one of said two proteins having at least eight consecutive amino acids.
    Type: Application
    Filed: February 11, 2010
    Publication date: December 15, 2011
    Applicant: MIKROGEN GmbH
    Inventor: Erwin Soutschek
  • Patent number: 7476498
    Abstract: In the area of virus diagnosis, in particular Epstein-Barr virus (EBV) diagnosis, methods for the detection of EBV and agents suitable for this purpose are provided, including peptides which are derived from p18-VCA and permit discrimination between acute and past EBV infection.
    Type: Grant
    Filed: July 29, 2005
    Date of Patent: January 13, 2009
    Assignee: Mikrogen Molekularbiologische Entwickslung-GmbH
    Inventors: Manfred Motz, Georg Bauer, Erwin Soutschek
  • Patent number: 7122302
    Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.
    Type: Grant
    Filed: June 29, 2001
    Date of Patent: October 17, 2006
    Assignee: Roche Diagnostic GmbH
    Inventors: Christoph Seidel, Ursula-Henrike Wienhues, Urban Schmitt, Manfred Motz, Michael Wiedmann, Barbara Upmeier, Erwin Soutschek
  • Publication number: 20060057563
    Abstract: In the area of virus diagnosis, in particular Epstein-Barr virus (EBV) diagnosis, methods for the detection of EBV and agents suitable for this purpose are provided, including peptides which are derived from p18-VCA and permit discrimination between acute and past EBV infection.
    Type: Application
    Filed: July 29, 2005
    Publication date: March 16, 2006
    Inventors: Manfred Motz, Georg Bauer, Erwin Soutschek
  • Publication number: 20050095584
    Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.
    Type: Application
    Filed: March 17, 2004
    Publication date: May 5, 2005
    Inventors: Christoph Seidel, Ursula-Henrike Wienhues, Urban Schmitt, Manfred Motz, Michael Wiedmann, Barbara Upmeier, Erwin Soutschek
  • Patent number: 6808711
    Abstract: The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence (SEQ. ID NO:1) MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAE DKGVNFAAFTSSETGSKVTNGGLALREAKIQAINEVEKFLKRIEEEALKL KEHGNSGQFLELFDLLLEVLESLEPIGIKGLKDFISEEAKCNPISTSER LIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK or a part sequence therefor having at least 10 consecutive amino acids, or exhibit the sequence of the protein 1829-22B, which has the amino acid sequence (SEQ.
    Type: Grant
    Filed: March 26, 2003
    Date of Patent: October 26, 2004
    Assignee: Mikrogen Molekularbiologische Entwicklungs-GmbH
    Inventors: Manfred Motz, Erwin Soutschek
  • Publication number: 20030185859
    Abstract: The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence 1 MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAE DKGVNFAAFTSSETGSKVTNGCLALREAKIQAINEVEKFLKRIEEEALKL KEHGNSGQFLELFDLLLEVLESLEPIGIKGLKDFIISEEAKCNPISTSER LIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK
    Type: Application
    Filed: March 26, 2003
    Publication date: October 2, 2003
    Applicant: Mikrogen Molekularbiologische Entwicklungs-GmbH
    Inventors: Manfred Motz, Erwin Soutschek
  • Patent number: 6610301
    Abstract: The present invention relates to immunologically active proteins from Borrelia burgdorferi which are present in a form which is free of other proteins derived from Borrelia burgdorferi and which exhibit the sequence of the protein 1829-22A, which has the amino acid sequence MKKFNLIIEALFAILLTACNFGLMEETKIALESSSKDVKNKILQIKKDAEDKGVNFAAFTSSETG SKVTNGGLALREAKIQAINEVEKFLKRIEEEALKLKEHGNSGQFLELFDLLLEVLESLEPIGIKG LKDFISEEAKCNPISTSERLIEVKVQIENKMEEVKRKQNLNKERKSNKGKKKK SEQ. ID NO.: 1 or a part sequence thereof having at least 10 consecutive amino acids, or exhibit the sequence of the protein 1829-22B, which has the amino acid sequence MIKYNKIILTLTLLASLLAACSLTGKARLESSVKDITNEIEKAIKEAEDAGVKTDAFTETQTGGK VAGPKIRAAKIRVADLTIKFLEATEEETITFKENGAGEDEFSGIYDLILNAAKAVEKIGMKDMTK TVEEAAKENPKTTANGIIEIVKVMKAKVENIKEKQTKNQK SEQ. ID NO.: 2 or a part sequence thereof having at least 10 consecutive amino acids.
    Type: Grant
    Filed: February 12, 1999
    Date of Patent: August 26, 2003
    Assignee: Mikrogen Molekularbiologische Entwicklungs - GmbH
    Inventors: Manfred Motz, Erwin Soutschek
  • Publication number: 20030129582
    Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.
    Type: Application
    Filed: June 29, 2001
    Publication date: July 10, 2003
    Inventors: Christoph Seidel, Ursula-Henrike Wienhues, Urban Schmitt, Manfred Motz, Michael Wiedmann, Barbara Upmeier, Erwin Soutschek
  • Patent number: 6306579
    Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.
    Type: Grant
    Filed: July 15, 1997
    Date of Patent: October 23, 2001
    Assignee: Roche Diagnostics GmbH
    Inventors: Christoph Seidel, Ursula-Henrike Wienhues, Urban Schmitt, Manfred Motz, Michael Wiedmann, Barbara Upmeier, Erwin Soutschek
  • Patent number: 6274307
    Abstract: Immunologically active peptides or polypeptides with a partial amino-acid sequence of the capsid proteins VP1 and VP2 of parvovirus B19 which permit tests to be carried out at low cost, sensitively and specifically for the determination of antibodies against human parvovirus B19 are made available. Short peptide sequences which, employed as antigen, serve to identify anti-B19 IgG-positive sera are identified. Furthermore, the production of these peptides using genetic engineering measures is disclosed. Other antigens which are produced by genetic engineering and which can be stably produced in a high yield in E.coli and subsequently purified therefrom are used as additional antigens for IgG detection. Finally, a set of antigens permits tests to be carried out to determine IgM antibodies against the virus. In addition, the components, produced by genetic engineering, of the surface proteins represent substances which can be used for prophylactic immunisation.
    Type: Grant
    Filed: May 15, 1997
    Date of Patent: August 14, 2001
    Assignee: MIKROGEN molekularbiologische Entwicklungs-GmbH
    Inventors: Erwin Soutschek, Manfred Motz
  • Patent number: 6270960
    Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207±10 to 1488±10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.
    Type: Grant
    Filed: June 12, 2000
    Date of Patent: August 7, 2001
    Assignee: Roche Diagnostics GmbH
    Inventors: Christoph Seidel, Ursula-Henrike Wienhues, Urban Schmitt, Manfred Motz, Michael Wiedmann, Barbara Upmeier, Erwin Soutschek
  • Patent number: 6136527
    Abstract: The cloning and sequencing of different polypeptides from the genome of a hepatitis C virus is disclosed. The polypeptides are prepared as non-fusion proteins in good yield. The polypeptide originating from the structure protein (core) is soluble under physiological conditions. Since the polypeptides have no foreign protein portions, they are preferably used in test kits and as vaccine.
    Type: Grant
    Filed: October 15, 1993
    Date of Patent: October 24, 2000
    Assignee: Roche Diagnostics GmbH
    Inventors: Klaus Fuchs, Manfred Motz, Michael Roggendorf, Erwin Soutschek
  • Patent number: 6096319
    Abstract: The present invention concerns a polypeptide which is composed of the amino acids 1207.+-.10 to 1488.+-.10 of a hepatitis C virus and of less than 20 foreign amino acids and the use of this polypeptide as an antigen in an immunological test.
    Type: Grant
    Filed: August 7, 1995
    Date of Patent: August 1, 2000
    Assignee: Roche Diagnostics GmbH
    Inventors: Christoph Seidel, Ursula-Henrike Wienhues, Urban Schmitt, Manfred Motz, Michael Wiedmann, Barbara Upmeier, Erwin Soutschek