Patents by Inventor Eugene Yeo

Eugene Yeo has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Patent number: 12709770
    Abstract: Provided are methods for identifying an RNA nucleobase that interacts with an RNA binding protein (RBP) including (a) crosslinking the RNA binding protein to an RNA fragment in a biological sample; (b) detecting an RNA-RBP complex, wherein the RNA-RBP complex comprises the RNA fragment bound by the RNA binding protein; (c) isolating the RNA fragment of the RNA-RBP complex; and (d) profiling the isolated RNA fragment bound by the RNA binding protein, thereby identifying the RNA nucleobase of the RNA fragment that interacts with the RNA binding protein.
    Type: Grant
    Filed: September 24, 2021
    Date of Patent: August 18, 2026
    Assignee: The Regents of the University of California
    Inventors: Eugene Yeo, Meredith Corley
  • Patent number: 12637682
    Abstract: Provided herein are compositions and methods for regulating protein translation. The compositions include a cap-conjugated oligonucleotide comprising an m7G cap or a variant or analog thereof conjugated to an oligonucleotide, wherein the oligonucleotide is capable of specifically hybridizing with a target sequence in an RNA molecule. The disclosure further provides methods of regulating translation of an mRNA in a cell, the method comprising contacting the cell with a cap-conjugated oligonucleotide comprising an m7G cap or a variant or analog thereof conjugated to an oligonucleotide, wherein the oligonucleotide comprises a sequence capable of specifically hybridizing with a target sequence in an RNA molecule.
    Type: Grant
    Filed: April 16, 2020
    Date of Patent: May 26, 2026
    Inventors: Eugene Yeo, Frederick Tan
  • Patent number: 12584125
    Abstract: Provided are methods for using chimeric proteins to produce RNA modifications that can be detected by sequencing methods, including methods detecting relative translation rates of various mRNAs. Also provided herein are compositions comprising chimeric proteins, wherein the chimeric proteins comprise a RNA editing protein and a ribosomal protein.
    Type: Grant
    Filed: March 12, 2021
    Date of Patent: March 24, 2026
    Assignee: The Regents of the University of California
    Inventors: Eugene Yeo, Kristopher W. Brannan, Ryan Marina, Isaac A. Chaim, Daniel A. Lorenz
  • Publication number: 20250320258
    Abstract: Provided are RNA recognition complexes that include an RNA-targeting agent; and a coronavirus-derived protein. In some embodiments, the RNA recognition complex further includes a linker. In some embodiments, the RNA-targeting agent includes CRISPR/Cas9 components (e.g., a Cas9 protein, a Cas 13b protein, or a Cas 13d protein). Also provided herein are methods of upregulating gene expression of a target RNA that include delivering a RNA recognition complex into a cell, wherein the RNA recognition complex comprises a RNA-targeting agent, and a coronavirus-derived protein, and wherein the RNA recognition complex binds to the target RNA and upregulates gene expression of the target RNA in the cell.
    Type: Application
    Filed: June 1, 2022
    Publication date: October 16, 2025
    Inventors: Eugene Yeo, Shengnan Xiang, Frederick Tan, Jonathan Schmok
  • Publication number: 20250289857
    Abstract: Provided herein is a molecule for use in directing splicing event. More specifically, provided herein is a molecule for use in targeted exon inclusion during mRNA splicing, along with compositions and methods of using the same.
    Type: Application
    Filed: March 11, 2025
    Publication date: September 18, 2025
    Inventors: Eugene Yeo, Jonathan Schmok
  • Publication number: 20250263697
    Abstract: Provided are compositions and methods of treating Coronavirus disease 2019 (COVID-19) in a subject, the method including administering to the subject a therapeutically effective amount of a composition comprising an exogenous nucleic acid and delivering the exogenous nucleic acid into a cell, wherein the exogenous nucleic acid comprises an antisense oligonucleotide, a small interfering RNA (siRNA), or locked nucleic acid, and wherein the exogenous nucleic acid binds to a target RNA and modulates gene expression of the target RNA, thereby treating Coronavirus disease 2019 (COVID-19) in the subject.
    Type: Application
    Filed: June 1, 2022
    Publication date: August 21, 2025
    Inventors: Eugene Yeo, Shengnan Xiang
  • Publication number: 20250257344
    Abstract: Provided herein are methods of regulating alternative polyadenylation (APA) of a target RNA in a cell, increasing stability of a target RNA in a cell, preventing degradation of a target RNA in a cell, preventing degradation of a target RNA in a cell, modifying localization of a target RNA in a cell, or increasing synthesis of a protein encoded by a target RNA in a cell, by administering to the cell an RNA regulation unit, wherein the RNA regulation unit comprises an RNA binding protein (RBP) and a gene-targeting agent, wherein the RNA binding protein binds proximal to a poly(A) signal and/or site.
    Type: Application
    Filed: January 31, 2023
    Publication date: August 14, 2025
    Inventors: Eugene Yeo, Pratibha Jagannatha
  • Publication number: 20250179129
    Abstract: Provided herein are zinc finger peptides comprising the amino acid sequence of SEQ ID NO: 1 (SDGDWICPDKKCGN-VNFARRTSCNRCGREKTT) and at least one substitution compared to SEQ ID NO: 1, wherein the zinc finger peptide is an engineered zinc finger peptide.
    Type: Application
    Filed: February 23, 2023
    Publication date: June 5, 2025
    Inventors: Kevin D. Corbett, Eugene Yeo, Qishan Liang
  • Publication number: 20250144241
    Abstract: Provided herein are methods of treating Huntington's disease in a subject, the method comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising: (a) a guide RNA (gRNA), wherein the guide RNA comprises a repeat sequence complementary to a target CAG-expansion RNA, and wherein the gRNA allele-selectively targets the target CAG-expansion RNA; and (b) a CRISPR-associated protein or a nucleic acid sequence encoding the CRISPR-associated protein, wherein the CRISPR-associated protein comprises a Cas13d polypeptide.
    Type: Application
    Filed: February 10, 2023
    Publication date: May 8, 2025
    Inventors: Eugene Yeo, Kathryn H. Morelli
  • Publication number: 20250115908
    Abstract: Provided herein are nuclear expressed antisense RNAs for interfering with a target repetitive RNA, the nuclear expressed antisense RNA comprising: (a) an oligonucleotide encoding an RNA-targeting guide comprising a sequence complementary to the target repetitive RNA; and (b) an oligonucleotide encoding a RNA binding protein (RBP)/ribonucleoprotein (RNP)-recruiting motif.
    Type: Application
    Filed: February 7, 2023
    Publication date: April 10, 2025
    Inventors: Eugene Yeo, Aaron Smargon, Samuel Hatch
  • Publication number: 20240417730
    Abstract: Provided are methods of modulating gene expression of a target RNA in a cell comprising (a) recruiting a modulation unit, wherein the modulation unit comprises an RNA binding protein (RBP), an exogenous RNA binding moiety, and a gene-editing agent; (b) delivering the modulation unit into the cell; and (c) detecting change in the target RNA translation, wherein the modulation unit modulates gene expression of the target RNA in the cell.
    Type: Application
    Filed: July 24, 2024
    Publication date: December 19, 2024
    Inventors: Eugene Yeo, En-Ching Luo
  • Patent number: 12163148
    Abstract: Disclosed herein is a technology to perform programmable RNA editing at single-nucleotide resolution using RNA-targeting CRISPR/Cas9. This approach, which Applicants have termed “Cas9-directed RNA editing” or “CREDIT,” provides a means to reversibly alter genetic information in a temporal manner, unlike traditional CRISPR/Cas9 driven genomic engineering which relies on permanently altering DNA sequence.
    Type: Grant
    Filed: July 11, 2022
    Date of Patent: December 10, 2024
    Assignee: The Regents of the University of California
    Inventors: Eugene Yeo, Kristopher Brannan, Ryan Marina, David Nelles
  • Patent number: 12139710
    Abstract: Provided are methods of modulating gene expression of a target RNA in a cell comprising (a) recruiting a modulation unit, wherein the modulation unit comprises an RNA binding protein (RBP), an exogenous RNA binding moiety, and a gene-editing agent; (b) delivering the modulation unit into the cell; and (c) detecting change in the target RNA translation, wherein the modulation unit modulates gene expression of the target RNA in the cell.
    Type: Grant
    Filed: October 27, 2021
    Date of Patent: November 12, 2024
    Assignee: The Regents of the University of California
    Inventors: Eugene Yeo, En-Ching Luo
  • Publication number: 20240344060
    Abstract: Disclosed are compositions and methods for simultaneously providing a gene therapy and preventing an adaptive immune response to a cell modified by the gene therapy by the immune system of a subject. In some embodiments, compositions of the disclosure modify a level of expression of an RNA molecule associated with a disease or disorder as well as inhibit expression or activity of a component of an adaptive immune response to mask the modified cell from a subject's immune system.
    Type: Application
    Filed: November 9, 2023
    Publication date: October 17, 2024
    Inventors: David A. NELLES, Ranjan BATRA, Eugene YEO
  • Publication number: 20240336918
    Abstract: Provided are methods of inhibiting activity of a RNA binding protein in a cell that include (a) generating a RNA binding N protein (RBP) binding agent comprising an RNA molecule comprising a binding site for the RNA binding protein; and (b) delivering the RBP binding agent into the cell, wherein the RBP binding agent binds to the RNA binding protein, thereby inhibiting the activity of the RNA binding protein in the cell.
    Type: Application
    Filed: July 8, 2022
    Publication date: October 10, 2024
    Inventors: Eugene Yeo, Frederick Tan
  • Publication number: 20230374566
    Abstract: Provided are methods for identifying an RNA nucleobase that interacts with an RNA binding protein (RBP) including (a) crosslinking the RNA binding protein to an RNA fragment in a biological sample; (b) detecting an RNA-RBP complex, wherein the RNA-RBP complex comprises the RNA fragment bound by the RNA binding protein; (c) isolating the RNA fragment of the RNA-RBP complex; and (d) profiling the isolated RNA fragment bound by the RNA binding protein, thereby identifying the RNA nucleobase of the RNA fragment that interacts with the RNA binding protein.
    Type: Application
    Filed: September 24, 2021
    Publication date: November 23, 2023
    Inventors: Eugene Yeo, Meredith Corley
  • Publication number: 20230365951
    Abstract: Cas9 polypeptides which target RNA and methods of using them are provided.
    Type: Application
    Filed: April 25, 2023
    Publication date: November 16, 2023
    Inventors: Eugene Yeo, David A. Nelles, Mark Fang, Ranjan Batra
  • Publication number: 20230279470
    Abstract: Described herein are efficient methods for preparing a library for use in comprising performing gene targeting or massively parallel reporter assays. The methods comprise performing hybrid capture of a library constant region.
    Type: Application
    Filed: February 15, 2023
    Publication date: September 7, 2023
    Inventors: Eric Van Nostrand, Eugene Yeo, Alexander Shishkin
  • Publication number: 20230183791
    Abstract: The present invention provides methods, antibodies and kits for detecting and/or quantifying expression of both non-nucleic acid molecules, such as proteins, and nucleic acid molecules in a single sample or single cell. The antibody is covalently conjugated to an oligonucleotide, such as a single-stranded DNA molecule, which comprises an identification tag and a blocking group, such as a ddNTP or an inverted dTTP, which prevents extension of the oligonucleotide by a polymerase. The method comprises the steps of reverse transcribing the conjugated oligonucleotide and the target nucleic acid simultaneously, amplifying both transcription production, and detecting the amplicons thereof. The method is also useful for detecting and/or quantifying the number of cells in a sample expressing a given non -nucleic acid molecule (e.g. protein).
    Type: Application
    Filed: March 23, 2018
    Publication date: June 15, 2023
    Inventors: Jonathan Scolnick, Eugene Yeo, Shawn Hoon
  • Patent number: 11667903
    Abstract: Cas9 polypeptides which target RNA and method of using them are provided.
    Type: Grant
    Filed: February 19, 2020
    Date of Patent: June 6, 2023
    Assignee: The Regents of the University of California
    Inventors: Eugene Yeo, David A. Nelles, Mark Fang, Ranjan Batra