Patents by Inventor Francesca Quattrini

Francesca Quattrini has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • PROCESS FOR THE PRODUCTION OF PRAMLINTIDE
    Publication number: 20100249370
    Abstract: Pramlintide, a peptide having the 37 amino acid sequence KCNTATCATQRLANFLVHSSNNFGPILPPT-NVGSNTY-NH2 is prepared via a convergent three-fragment synthesis strategy from the fragments comprising the amino acid residues 1-12, 13-24 and 25-37, respectively.
    Type: Application
    Filed: June 30, 2008
    Publication date: September 30, 2010
    Applicant: LONZA AG
    Inventors: Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos
  • METHOD FOR PEPTIDE SYNTHESIS
    Publication number: 20100197891
    Abstract: A new method of anchoring a growing peptide chain during chemical synthesis to a solid-phase support is devised. Novel amino acid derivatives and peptide derivatives, both unbonded and bonded to a solid-phase support, are also provided.
    Type: Application
    Filed: October 3, 2007
    Publication date: August 5, 2010
    Inventors: Matthieu Giraud, Fernando Albericio, Francesca Quattrini, Oleg Werbitzky, Katja Senn, Michaela Williner
  • Cyclization of a Peptide
    Publication number: 20080097079
    Abstract: An improved method for cyclization of peptide (H)-D-Phe-Cys-Tyr-D-Trp-Lys-Val-Cys-Trp(NH2) by cystine formation is devised.
    Type: Application
    Filed: October 24, 2005
    Publication date: April 24, 2008
    Inventors: Francesca Quattrini, Stephane Varray, Oleg Werbitzky, Thomas Zeiter