Abstract: Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli. Also disclosed herein are proteins encoded by cssA and cssB genes as well as constructs containing the genes and methods of using thereof.

Abstract: A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO. 2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Abstract: Disclosed herein are red blood cell (RBC) preparations and methods of making and using thereof for treating, preventing or inhibiting enterotoxigenic Escherichia coli (ETEC) infections. In particular, bovine RBC preparations are shown to reduce ETEC adhesion when administered orally. Also disclosed are kits comprising RBC preparations for the treatment of ETEC infections.

Abstract: A monoclonal antibody to a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Abstract: Disclosed herein are antigens that stimulate protective antibodies against enterotoxigenic Escherichia coli. Also disclosed herein are proteins encoded by cssA and cssB genes as well as constructs containing the genes and methods of using thereof.

Abstract: Novel burst-free, sustained release biocompatible and biodegrable microcapsules which can be programmed to release their active core for variable durations ranging from 1-100 days in an aqueous physiological environment. The microcapsules are comprised of a core of polypeptide or other biologically active agent encapsulated in a matrix of poly(lactide/glycolide) copolymer, which may contain a pharmaceutically-acceptable adjuvant, as a blend of upcapped free carboxyl end group, and end-capped forms ranging in ratios from 100/0 to 1/99.

Abstract: This invention relates to an immunostimulating composition comprising encapsulating microspheres, which may contain a pharmaceutically-acceptable adjuvant, wherein said microspheres having a diameter between 1 nanometer (nm) to 10 microns (um) are comprised of (a) a biodegradable-biocompatible poly(DL-lactide-co-glycolide) as the bulk matrix, wherein the relative ratio between the amount of lactide and glycolide components are within the range of 40:60 to 0:100 and wherein said poly (DL-lactide-co-glycolide) is present in an uncapped form and an end-capped form wherin a ratio of uncapped to end-capped forms is 99/1 to 1/99, and (b) an immunogenic substance comprising Colony Factor Antigen (CFA/II), hepatitis B surface antigen (HbsAg), or a physiologically similar antigen that serves to elicit the producton of antibodies in animal subjects. The preparation of its composition and its use as a vaccine is also disclosed.

Abstract: Novel burst-free, sustained release biocompatible and biodegrable microcapsules which can be programmed to release their active core for variable durations ranging from 1-100 days in an aqueous physiological environment. The microcapsules are comprised of a core of polypeptide or other biologically active agent encapsulated in a matrix of poly(lactide/glycolide) copolymer, which may contain a pharmaceutically-acceptable adjuvant, as a blend of upcapped free carboxyl end group and end-capped forms ranging in ratios from 100/0 to 1/99.