Patents by Inventor Gerald B. Price

Gerald B. Price has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Human and mammalian DNA replication origin consensus sequences
    Publication number: 20020164801
    Abstract: The present invention relates to a human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO: 1); and AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWWKDAKWKMWRKTT (SEQ ID NO: 4). A method for the control of initiation of mammalian DNA replication which comprises the steps of: a) inserting a consensus sequence coding for a sequence of the present invention together with a DNA fragment to form a vector capable of expression of the DNA fragment; b) introducing the vector of step a) into mammalian cells in vitro.
    Type: Application
    Filed: March 6, 2002
    Publication date: November 7, 2002
    Inventors: Gerald B. Price, Maria Zannis-Hadjopoulos, Torsten O. Nielsen, Nandini H. Cossons
  • Human and mammalian data replication origin consensus sequences
    Patent number: 6410722
    Abstract: The present invention relates to a human or mammalian DNA replication origin consensus sequence which consists of a sequence selected from the group consisting of CCTMDAWKSGBYTSMAAWYWBCMYTTRSCAAATTCC (SEQ ID NO:1); and AWMTWAAKRAWRWWKKDAVWWGAKRWWKWVWHRASSACMDWKAAKTWKGGWTWARRYWKGRKMWWTWKAWSDATAKWWWKDAKWKMWRKTT (SEQ ID NO:4). A method for the control of initiation of mammalian DNA replication which comprises the steps of: a) inserting a consensus sequence coding for a sequence of the present invention together with a DNA fragment to form a vector capable of expression of the DNA fragment; b) introducing the vector of step a) into mammalian cells in vitro.
    Type: Grant
    Filed: June 9, 1999
    Date of Patent: June 25, 2002
    Assignee: McGill University
    Inventors: Gerald B. Price, Maria Zannis-Hadjopoulos, Torsten O. Nielsen, Nandini H. Cossons