Patents by Inventor Gregory Alan Soloff

Gregory Alan Soloff has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Peptide sequences and compositions
    Patent number: 8444995
    Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
    Type: Grant
    Filed: May 7, 2012
    Date of Patent: May 21, 2013
    Assignee: PepTCell, Ltd.
    Inventors: Gregory Alan Soloff, Wilson Romero Capparros-Wanderlay
  • Treatment of Viral Infections
    Publication number: 20120283334
    Abstract: The invention provides compositions, medicaments and methods of treatment of viral infections, especially respiratory disorders caused by viral infections. In particular, the invention relates to the treatment of acute viral infections using a range of related 1-phenyl-2-amino ethanol, ethanal, and ethane derivatives.
    Type: Application
    Filed: August 10, 2010
    Publication date: November 8, 2012
    Applicant: Biocopea, Ltd.
    Inventors: John Brew, Robin Mark Bannister, Gregory Alan Soloff, Wilson Capparros Wanderlay, Olga Pleguezuelos Mateo